KEGG   Chloroflexus aggregans: Cagg_1290Help
Entry
Cagg_1290         CDS       T00824                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cag  Chloroflexus aggregans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cag00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1589041..1589805
Genome map
AA seq 254 aa AA seqDB search
MSVLVGRRIAITRPAGRGDTLAARLRALGAIPLLTPLIAYAPPADPAPLQHALAQLAAGT
YDWLVVTSRQAVQVLAEATVPTTTAIAAVGKATAADCRRTWGREPAGVPDEELGAALPNV
MGTLTGKRILLPCADIAPSTLTAALQAAGAIVDRVTAYRTISSPAAAELAAALRSGTIDA
IVLASGSAARQIPALLPPQTQCPPLVCIGPSTAAVCTELGLPVAAIAIRPNDDALLAALE
RVFLSQDAQPVSGF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgcttgtaggtcgtcggatagccatcacccgtccggcaggccgcggcgataca
ctcgctgcacgattgcgcgcactcggcgccattccgttactcacgccgctcatcgcgtat
gcaccacctgccgatccggccccactgcaacacgcgctggcccaactcgctgccggcacg
tatgattggctcgtggtcacaagccggcaagcggtccaagtgttagccgaggccacagtg
ccgacaaccacagccatcgctgctgttgggaaggcaaccgctgccgattgccgccgcacc
tgggggcgcgaaccggccggtgtacctgatgaggaactcggagccgcgctaccgaacgtt
atgggcacgctcaccgggaagcggatattgctgccgtgcgccgacattgccccatcaaca
ctgaccgcagcactccaagcagccggtgcaattgttgatcgggtaactgcctaccgcacg
atcagtagtccggctgccgccgaactcgccgctgcgctacggagcggtacgattgatgca
attgtactggccagcggatcggccgctcgccaaataccggccctcttgccgccacaaact
cagtgtccaccattagtctgcattgggccgagtactgctgccgtctgcacagaattggga
ctaccggttgccgccatcgctatacgccccaacgacgatgcattgctggcggcgttggaa
cgggtttttctcagtcaggatgcgcaacctgtgagcgggttttga

DBGET integrated database retrieval system