KEGG   Chloroflexus aggregans: Cagg_1390Help
Entry
Cagg_1390         CDS       T00824                                 

Definition
(GenBank) peptidase M42 family protein
Organism
cag  Chloroflexus aggregans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1715315..1716379)
Genome map
AA seq 354 aa AA seqDB search
MQEHQISFLKRLLAAPGPSGDEDRAARVWRTEARTFADTVYSDVLGNSFAVLEGSGPRIL
LAGHIDEIGLMISHIDDNGFLFFSPIGGWDPQVLIGQRVRLLGRHGEIIGVIGKKPIHLL
KSDDRDRATKIEQMWIDIGVTNRAEASELVNVGDVGVIDAPVYELRGGRIVSRSIDNRIG
AFTVLEALRLLSQNRPAARVAAVATTQEEITFGGATTAAFSFDPQVAIVVDVTFATDHPD
ADQRQWNVVKLGGGPVLSRGSANSGRVFRRLVELAEREGIPYSVQISPRYTGTDADAIHH
VRGGIASAVISIPNRYMHSPNEMIALSDVEYAVQLIAAFVHSVNSVNEFIPVDE
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaacatcaaatctcattcctcaagcgccttcttgccgcaccggggccttcagga
gatgaagatcgtgccgcacgggtttggcgtaccgaggcccggactttcgccgatacggtg
tacagtgatgtgcttgggaatagttttgcggtattggaaggaagtggtccccggattcta
ctggccggccatatcgacgagattgggttgatgattagccatattgatgataacggcttt
ctctttttcagtccaatcggtggttgggatccgcaggtcttaattgggcagcgagtacgt
ttgctgggtcggcatggtgaaattattggagtgatcgggaagaaaccgattcacctgctg
aaatccgatgatcgcgatcgggcgaccaagatcgaacagatgtggatcgacattggcgtc
acgaatcgtgccgaagcaagtgagctggtgaatgtcggtgatgtaggtgtgatcgacgca
cctgtctacgaattacgcggtggtcgtatcgttagtcgctcgattgacaatcggatcggg
gcgtttaccgtattggaggcgttacgtttgttgagccagaatcgcccggccgctcgtgtc
gcagcggttgcgacgacccaagaagagattaccttcggtggtgcaacaacggcggcgttt
agttttgatccacaggtggcgattgtggtcgatgttacttttgccaccgatcatcccgac
gccgaccaacggcaatggaacgtggtgaagcttggtggtggtccggtgttgtcacgcggc
tcagccaacagtgggcgggtgtttcgccgcttagttgaactggccgaacgcgaagggatt
ccgtatagtgtgcaaatctcgccgcgctataccggtaccgatgcggatgcgatccatcac
gtgcgtggtgggattgccagtgcggtcatctccattcccaatcgctatatgcattcgccg
aacgagatgatcgcattgagtgatgttgaatacgcggtgcaattgatcgccgcattcgtt
cattctgtgaatagtgtcaatgaattcattccagttgatgaatga

DBGET integrated database retrieval system