KEGG   Chloroflexus aggregans: Cagg_1836Help
Entry
Cagg_1836         CDS       T00824                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cag  Chloroflexus aggregans
Pathway
cag00260  Glycine, serine and threonine metabolism
cag00750  Vitamin B6 metabolism
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
cag01120  Microbial metabolism in diverse environments
cag01230  Biosynthesis of amino acids
Module
cag_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cagg_1836
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cagg_1836
Enzymes [BR:cag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cagg_1836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF3439
Motif
Other DBs
NCBI-ProteinID: ACL24731
JGI: Cagg1836
UniProt: B8GBA3
Position
complement(2252194..2253519)
Genome map
AA seq 441 aa AA seqDB search
MYHAWFAAQDDPNERYPLTEVVYYSRSGGLLEVQHDMAALAQRSPEEWKRLFDERWMRTT
WPYGSGVWGKKEWVCPIVDNDNVVSMFEGGTNLFWAERFGREIGLEDLWIKMCGNSHTGS
FKDLGMTVLVSVVKQMISEGKPIRAIACASTGDTSAALAAYGAAAGIPTIVFLPKGKVSI
AQLVQPVAHGALVLALDTDFDGCMRIVREITANPDNGIYLANSLNSLRIEGQKTVGIEIV
QQFDWEVPDWIIIPGGNLGNTFALGKGLLMMYELGLINRLPRIVTAQAANANPLYRSYLT
GFREYQPIKAQPTAASAIQIGDPVSINRAISILRRFNGIVEQATEQELADAAARADRTGA
YACPHTGVALAALIKLVQRGEIKRSDRVVVISTAHGLKFSRFKVEYHEGTLRDVIGQYRN
PPIELPPDIDAVRREIDRRFG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacgcttggtttgccgctcaagatgaccccaacgagcgttatccgctcacagaa
gtagtgtactacagtcgatcaggcgggttattggaagtgcagcacgatatggccgcacta
gctcaacgcagtcctgaagagtggaaacgattattcgatgagcgctggatgcgcacaaca
tggccgtatggtagtggagtatggggcaagaaagagtgggtctgcccgattgtcgataac
gacaatgtcgtcagtatgtttgaaggcgggaccaacctcttctgggccgaacggtttggg
cgtgagatcgggctagaagatttgtggatcaagatgtgtggcaattcgcacaccggctcg
ttcaaagatctcggaatgacggtgctggtgagcgttgtcaagcagatgatcagcgagggt
aagccgatacgtgcgattgcctgtgcctcaaccggtgatacatcggcggcattggctgca
tacggtgcggctgccgggattcccaccattgtctttctacccaaaggcaaggtgagcatt
gcccaattagtacagccggttgcccacggtgcgcttgtgctggcactcgataccgatttc
gatggctgcatgcggattgtccgcgaaatcacggctaatcccgacaacggcatctattta
gccaattcgctcaactcgctgcggatcgaggggcaaaagacggttgggatcgagatcgtg
cagcaattcgattgggaagtgccggactggattattattcccggcggtaatcttggcaat
acctttgccctcggcaaaggcctgctcatgatgtacgagttagggttgatcaaccgcttg
ccacggattgtgactgcacaagcagccaacgccaatccactctatcgctcgtacctgacc
ggtttccgcgaatatcagccgatcaaagcccaaccgacagcggcgagtgcgattcagatc
ggcgatccggtcagcattaatcgggcgatcagcatcctgcgtcgcttcaacggcatcgtc
gaacaggcaaccgagcaggaactcgccgatgccgccgctcgtgccgaccgcaccggtgca
tatgcctgcccccataccggtgtcgcgttggccgcactgatcaaattggtgcaacgtggc
gagatcaagcgcagtgatcgagtcgttgtcatctcgaccgcgcatgggcttaagtttagc
cgtttcaaagtcgagtaccatgaaggcacactgcgcgacgtaatcggccagtaccgtaac
ccgccaatcgaactgccaccggatatcgatgcagtacgccgcgaaatcgaccgccggttc
ggatag

DBGET integrated database retrieval system