KEGG   Chloroflexus aggregans: Cagg_1836Help
Entry
Cagg_1836         CDS       T00824                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cag  Chloroflexus aggregans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cagg_1836
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cagg_1836
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cagg_1836
Enzymes [BR:cag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cagg_1836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2252194..2253519)
Genome map
AA seq 441 aa AA seqDB search
MYHAWFAAQDDPNERYPLTEVVYYSRSGGLLEVQHDMAALAQRSPEEWKRLFDERWMRTT
WPYGSGVWGKKEWVCPIVDNDNVVSMFEGGTNLFWAERFGREIGLEDLWIKMCGNSHTGS
FKDLGMTVLVSVVKQMISEGKPIRAIACASTGDTSAALAAYGAAAGIPTIVFLPKGKVSI
AQLVQPVAHGALVLALDTDFDGCMRIVREITANPDNGIYLANSLNSLRIEGQKTVGIEIV
QQFDWEVPDWIIIPGGNLGNTFALGKGLLMMYELGLINRLPRIVTAQAANANPLYRSYLT
GFREYQPIKAQPTAASAIQIGDPVSINRAISILRRFNGIVEQATEQELADAAARADRTGA
YACPHTGVALAALIKLVQRGEIKRSDRVVVISTAHGLKFSRFKVEYHEGTLRDVIGQYRN
PPIELPPDIDAVRREIDRRFG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacgcttggtttgccgctcaagatgaccccaacgagcgttatccgctcacagaa
gtagtgtactacagtcgatcaggcgggttattggaagtgcagcacgatatggccgcacta
gctcaacgcagtcctgaagagtggaaacgattattcgatgagcgctggatgcgcacaaca
tggccgtatggtagtggagtatggggcaagaaagagtgggtctgcccgattgtcgataac
gacaatgtcgtcagtatgtttgaaggcgggaccaacctcttctgggccgaacggtttggg
cgtgagatcgggctagaagatttgtggatcaagatgtgtggcaattcgcacaccggctcg
ttcaaagatctcggaatgacggtgctggtgagcgttgtcaagcagatgatcagcgagggt
aagccgatacgtgcgattgcctgtgcctcaaccggtgatacatcggcggcattggctgca
tacggtgcggctgccgggattcccaccattgtctttctacccaaaggcaaggtgagcatt
gcccaattagtacagccggttgcccacggtgcgcttgtgctggcactcgataccgatttc
gatggctgcatgcggattgtccgcgaaatcacggctaatcccgacaacggcatctattta
gccaattcgctcaactcgctgcggatcgaggggcaaaagacggttgggatcgagatcgtg
cagcaattcgattgggaagtgccggactggattattattcccggcggtaatcttggcaat
acctttgccctcggcaaaggcctgctcatgatgtacgagttagggttgatcaaccgcttg
ccacggattgtgactgcacaagcagccaacgccaatccactctatcgctcgtacctgacc
ggtttccgcgaatatcagccgatcaaagcccaaccgacagcggcgagtgcgattcagatc
ggcgatccggtcagcattaatcgggcgatcagcatcctgcgtcgcttcaacggcatcgtc
gaacaggcaaccgagcaggaactcgccgatgccgccgctcgtgccgaccgcaccggtgca
tatgcctgcccccataccggtgtcgcgttggccgcactgatcaaattggtgcaacgtggc
gagatcaagcgcagtgatcgagtcgttgtcatctcgaccgcgcatgggcttaagtttagc
cgtttcaaagtcgagtaccatgaaggcacactgcgcgacgtaatcggccagtaccgtaac
ccgccaatcgaactgccaccggatatcgatgcagtacgccgcgaaatcgaccgccggttc
ggatag

DBGET integrated database retrieval system