KEGG   Chloroflexus aggregans: Cagg_2033Help
Entry
Cagg_2033         CDS       T00824                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
cag  Chloroflexus aggregans
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cag00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cag00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:cag00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:cag00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:cag00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2495061..2495972
Genome map
AA seq 303 aa AA seqDB search
MQADKVKVAILGSGNIGTDLMYKLLRQPGPMELALVAGIDPASEGLARARQLGIPTSASG
IEAILADPEIRIVFDATSAKAHVRHARLLREHGRIAIDLTPAARGPYVVPPVNLGMHLDA
PNVNLITCGGQATIPLVYAVSRVTPVRYAEMVSTVSSRSAGPGTRQNIDEFTFTTARGLE
VIGGAHQAKAIIILNPANPPILMRNTIYVLPEGEFDETAVQNSVAQMVADVQQYVPGYRL
KNRPVIERRATPWGERPVLIMLLEVEGAGDFLPRYAGNLDIMTSAARRVGEVFAQHILKE
VAA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccgacaaagtcaaagtcgccatcctcggttccggtaatataggcaccgatttg
atgtacaaactgttgagacagccgggaccgatggagctggcgctggtagccgggatcgat
cctgcgtcggaggggttagcccgggccagacagttgggcattccgaccagtgccagcggt
attgaggcgattctggccgatcccgagattcggatcgtgtttgacgcgaccagtgcaaag
gcgcatgtgcgtcatgccagactgttacgggaacacggacgtatcgcgattgatctgact
ccggcggcgcgcgggccgtatgtcgtgccaccggtgaatcttgggatgcatcttgatgcg
ccgaatgtcaacttgataacctgtggtggtcaagcaaccatcccgctggtctatgcggtc
agccgagtgacaccggtgcgttatgccgagatggtgagcaccgtgtcgagccgctcggca
ggaccgggaacgcgccaaaatatcgatgagtttacctttaccacggcacgtggcttggag
gtcatcggtggggcgcaccaagcgaaagcgatcatcattctgaatccggccaacccaccg
attctgatgcggaataccatttatgtattaccggaaggggagtttgacgaaacggccgta
caaaactctgtagcacagatggtcgccgatgtccagcagtacgttcccgggtaccggttg
aagaatcgaccggtaatagaacgacgggcgacaccgtggggtgagcgaccggtgttgatt
atgctgctcgaagttgagggggcaggtgacttcttgccacgctacgccgggaatctcgac
atcatgacatcggcggcgcggcgagtaggggaagtattcgcgcagcacatactgaaggag
gtggcagcatga

DBGET integrated database retrieval system