KEGG   Chloroflexus aggregans: Cagg_2033Help
Entry
Cagg_2033         CDS       T00824                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
cag  Chloroflexus aggregans
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cagg_2033
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cagg_2033
   00650 Butanoate metabolism
    Cagg_2033
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Cagg_2033
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cagg_2033
   00622 Xylene degradation
    Cagg_2033
   00621 Dioxin degradation
    Cagg_2033
Enzymes [BR:cag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Cagg_2033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2495061..2495972
Genome map
AA seq 303 aa AA seqDB search
MQADKVKVAILGSGNIGTDLMYKLLRQPGPMELALVAGIDPASEGLARARQLGIPTSASG
IEAILADPEIRIVFDATSAKAHVRHARLLREHGRIAIDLTPAARGPYVVPPVNLGMHLDA
PNVNLITCGGQATIPLVYAVSRVTPVRYAEMVSTVSSRSAGPGTRQNIDEFTFTTARGLE
VIGGAHQAKAIIILNPANPPILMRNTIYVLPEGEFDETAVQNSVAQMVADVQQYVPGYRL
KNRPVIERRATPWGERPVLIMLLEVEGAGDFLPRYAGNLDIMTSAARRVGEVFAQHILKE
VAA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccgacaaagtcaaagtcgccatcctcggttccggtaatataggcaccgatttg
atgtacaaactgttgagacagccgggaccgatggagctggcgctggtagccgggatcgat
cctgcgtcggaggggttagcccgggccagacagttgggcattccgaccagtgccagcggt
attgaggcgattctggccgatcccgagattcggatcgtgtttgacgcgaccagtgcaaag
gcgcatgtgcgtcatgccagactgttacgggaacacggacgtatcgcgattgatctgact
ccggcggcgcgcgggccgtatgtcgtgccaccggtgaatcttgggatgcatcttgatgcg
ccgaatgtcaacttgataacctgtggtggtcaagcaaccatcccgctggtctatgcggtc
agccgagtgacaccggtgcgttatgccgagatggtgagcaccgtgtcgagccgctcggca
ggaccgggaacgcgccaaaatatcgatgagtttacctttaccacggcacgtggcttggag
gtcatcggtggggcgcaccaagcgaaagcgatcatcattctgaatccggccaacccaccg
attctgatgcggaataccatttatgtattaccggaaggggagtttgacgaaacggccgta
caaaactctgtagcacagatggtcgccgatgtccagcagtacgttcccgggtaccggttg
aagaatcgaccggtaatagaacgacgggcgacaccgtggggtgagcgaccggtgttgatt
atgctgctcgaagttgagggggcaggtgacttcttgccacgctacgccgggaatctcgac
atcatgacatcggcggcgcggcgagtaggggaagtattcgcgcagcacatactgaaggag
gtggcagcatga

DBGET integrated database retrieval system