KEGG   Chloroflexus aggregans: Cagg_2091Help
Entry
Cagg_2091         CDS       T00824                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cag  Chloroflexus aggregans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cagg_2091
Enzymes [BR:cag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cagg_2091
Exosome [BR:cag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cagg_2091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2559512..2561545
Genome map
AA seq 677 aa AA seqDB search
MSEGEQTRRTRRKQATPVTEATAPMTTAEVEHTTTEGPEPSAATTAMMKSILSEDDIYLF
NQGTHYRLYNKFGAQPVTIEGVPGTYFAVWAPNAEYVAVIGDWNNWDPGAHPLRQRGFSG
VWEGFIPHIGKGMRYKFHIASRYYGYREDKTDPFGSYFEVAPQTAAIIWDREYTWSDQQW
MSERGQRQRLDAPISIYEVHLGSWRRKPEEDNRPLTYRELAHELVEHVKACGFTHVELLP
VTEHPFYGSWGYQSTGMFAPTSRYGTPQDFMYFVDYLHQHGIGVILDWVPSHFPTDGHGL
AYFDGTHLYEHADPRKGYHPDWGSYIYNYGRNEVRSFLISSALCWLDKFHIDGLRVDAVA
SMLYLDYSRRPGEWIPNEYGGNENLEAISFLRELNTQIYKYYPDVQTIAEESTAWPMVSR
PVYVGGLGFGFKWDMGWMHDTLQYFRRDPIYRRFHHNELTFRGLYMFTENYVLPLSHDEV
VHGKGSLLDKMAGDVWQKFANLRLLYSYMFAQPGKKLLFMGGEFGQWREWSHDTSLDWHL
LMFPSHQGMLRLISDLNRLYRSEPALHELDCDPKGFEWIDANDADTSVYSFLRKNRHGET
ILVVLNATPVVREDYRVGVPFGGWWRELLNSDSEYYWGSGQGNAGGVMAEELPSHGRPFS
LRLRLPPLGALYFKHSG
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaggtgagcaaacccgccgcacccggcgtaaacaagcaacaccggtcaccgaa
gcgacggcaccgatgaccacagcagaggttgaacatacgactaccgaaggacctgaaccg
tcggcagctaccacggcgatgatgaagagcattctgagtgaggatgacatttatctcttc
aatcagggcacccactaccggctctacaacaaattcggcgcccagccggtgacgattgaa
ggcgtacccggtacctatttcgcagtgtgggcaccgaatgctgaatacgtcgccgttatt
ggcgactggaacaattgggaccccggcgcacatccgctgcgccagcgaggcttttccggt
gtgtgggaagggttcattccccacatcggcaaaggcatgcgctacaaattccatattgcc
tcacgctattatggctaccgcgaagacaagaccgatccctttggcagctattttgaagta
gcaccgcaaacggcggctatcatctgggatcgggagtatacgtggtcggatcagcagtgg
atgagcgaacgcggtcagcgccagcgtctcgatgcgccgatctcgatctacgaggttcac
ctcggttcatggcgacgtaagccggaggaggataaccgccctctcacctaccgggaactg
gcccacgaactggtcgagcatgtgaaagcatgcggctttactcacgtggagctgctaccg
gtgaccgaacaccccttctacggctcgtggggctaccaatcgaccgggatgttcgcacca
accagccggtatggtaccccgcaagattttatgtactttgtcgattacctgcaccagcac
ggtattggtgtgatcctcgactgggtaccgagccactttccaaccgatggtcacggactg
gcgtatttcgacggcacgcatctctacgaacacgccgatccgcgcaaaggttatcatccc
gactgggggagctacatctacaattacggtcgcaacgaggtgcgtagctttctgatcagt
tcggccctgtgctggctcgacaagttccatattgacggtttgcgcgtcgatgccgttgcc
agtatgctctatctcgactactcgcggcgacccggtgagtggattccgaatgaatacggc
ggtaatgaaaatctggaagcgattagcttcttgcgtgaactgaacacccaaatctacaag
tattatcccgacgtgcaaaccattgccgaagagagcacagcgtggccaatggtttcgcgc
ccggtctatgtgggtgggttaggctttggcttcaagtgggatatggggtggatgcacgac
acactgcaatacttccgccgcgatcccatctaccgtcgcttccaccacaacgagctgacc
ttccgtggcctctatatgtttaccgagaactacgtactcccgctctcgcacgatgaagtc
gttcacggcaaggggtcgctgctcgataaaatggccggcgatgtttggcagaagttcgcc
aacttacgcttgctctactcctatatgtttgcccaacccggtaagaagctgctcttcatg
ggcggtgagtttgggcaatggcgggaatggtcgcacgatacgagcctcgattggcatttg
ctgatgttcccttcccatcaaggaatgcttcggctcatcagtgacctcaaccgactttac
cgcagtgaaccggctttgcacgaacttgactgtgatccgaaggggttcgagtggattgac
gccaatgatgccgataccagtgtgtatagctttttgcgcaagaatcggcacggcgagacg
attttggtggtgctgaatgcaacaccggtagtccgcgaagactaccgtgtcggcgtaccg
tttggtggttggtggcgagagttactgaacagcgattcggaatactattgggggagtggg
caaggaaatgccggtggtgtgatggctgaagaactaccatcgcatggacggccattctcg
ttgcgcttgcgcttaccgccgttgggagcgttgtacttcaagcatagcggatag

DBGET integrated database retrieval system