KEGG   Chloroflexus aggregans: Cagg_2257Help
Entry
Cagg_2257         CDS       T00824                                 

Definition
(GenBank) Stearoyl-CoA 9-desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
cag  Chloroflexus aggregans
Pathway
cag01040  Biosynthesis of unsaturated fatty acids
cag01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Cagg_2257
Enzymes [BR:cag01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Cagg_2257
Lipid biosynthesis proteins [BR:cag01004]
 Desaturase
  First
   Cagg_2257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: ACL25137
JGI: Cagg2257
UniProt: B8GD70
Position
complement(2755013..2755897)
Genome map
AA seq 294 aa AA seqDB search
MARTVPGTEPKLEKSPLEKFVVLLVVVLPFLGTIYAMVMLWQQYVDWLDVTLMLTLYVIS
GLGITIGFHRMLTHKSFETSRPLKALLLIMGCMALEGDPTSWASTHIQHHAHSDDEDDPH
SPLEGLWHSHVGWLFTHKHNIEMYGKWLTKDPTIVWVTKTWWLWAALGIIIPTLIAGWSG
LIWGGLVRIFLTHHITWSVNSICHTFGRRDFNTRDASRNNFIVGLLAFGEGWHNNHHAFP
RSAFHGLRWWQIDISAYIIRGLEKLGLVWNVHRVKPEDLHKRQIAPVLQEVMGD
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaccgttcctggcaccgaacccaaactcgaaaaatcaccgctcgaaaaattt
gtcgtcttgttggtcgtcgtcctcccttttttgggcaccatttacgcgatggtcatgctc
tggcaacaatacgttgattggctcgatgtgaccctcatgctcacgctgtacgttatctcg
gggttaggcattaccatcggttttcaccgcatgctcacgcacaaaagctttgagacgagc
cgtccgcttaaggccctcttgttgattatgggatgtatggccctcgaaggtgatccgaca
tcgtgggcctcgacccatattcagcatcatgcccactccgatgatgaagatgatccacat
agcccgctcgaaggcctatggcattcccatgtaggctggctcttcacccataagcacaat
atcgagatgtacggcaaatggctgacgaaggatccgaccatcgtgtgggtaacgaagacg
tggtggctatgggccgcgctgggtattattatcccaacccttattgccggctggagtggg
ttgatctgggggggattggtacggattttcctgacccaccacatcacgtggagtgttaac
tcgatctgtcatacgtttggtcgccgtgacttcaatacacgtgacgctagtcgcaacaat
tttatcgtcggattactcgcattcggtgagggttggcacaataaccatcacgcctttcca
cgctcagctttccacggtttgcgttggtggcagatcgacatttcggcttatattatccgt
ggcctcgaaaaactcggtttagtgtggaatgtgcaccgcgttaaaccggaggatctccac
aaacgccagattgcaccggtgttgcaagaggtgatgggcgattag

DBGET integrated database retrieval system