KEGG   Chloroflexus aggregans: Cagg_2272Help
Entry
Cagg_2272         CDS       T00824                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cag  Chloroflexus aggregans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cagg_2272
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cagg_2272
Enzymes [BR:cag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Cagg_2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2775445..2776557
Genome map
AA seq 370 aa AA seqDB search
MTRFVVKLGTSVLTAGTDRLHRPYFVELARQIVRLKADGHEVVLVSSGAIAAGKERLGAD
PRRRSNIPLKQVFAAVGQSRLMHIYEQIFDLYGLQVAQALLTRDDLRDRRRYLNARNTLT
LCLAQGIVPIINENDAVATAEIRVGDNDNLSALVAGLIDADLLLILTDIAGLYSADPRTD
PTAELLREVPVIDERIWAMAGGSGTHRGTGGMQTKIQAADLATRSGVAVVIAAGHEPDVI
VRVANGERIGTYFPATTSHPDARQRWILAETVRHSRIVIDEGAAMALIQYGKSLLAAGIR
EVNGEFDRGQTVRIFDLAGREIARGLTQYRSSDLRLIAGLRSHQIGPVLGYDYGPEIVHR
DDMVVLATKE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaccagattcgttgttaaattaggcacaagtgtgctcactgccggtaccgaccggcta
caccgaccttattttgtcgaattggcccgtcagattgtgcgtctcaaagcagacggtcac
gaagtcgtgttggtctcgtcgggtgcgattgccgccggtaaagaacgtctcggcgccgat
ccacgccggcggagcaatattccgctcaagcaagtgttcgccgcggtgggtcagagccga
ttaatgcacatctacgaacagattttcgatctctacggactgcaagtggcgcaggcatta
ctgacccgcgacgatctgcgtgatcgccgacgctatctgaatgcccgcaatacccttacc
ctttgccttgcccaaggaattgtgccgattatcaacgagaatgatgcggtggcaaccgcc
gagattcgggtcggcgataacgataatctctcggcactggtggccggcttgatcgacgcc
gacctgctcttgatcctgaccgatattgccggtctctacagcgccgatccacgcaccgat
ccgactgccgaactgctgcgtgaggtaccggtcatcgacgaacgaatttgggcaatggcc
ggtgggagcggtacgcatcgcggcaccggcgggatgcagaccaaaatacaagctgccgat
ctggctactcgttcaggagtggcggttgtcattgccgccggtcacgaaccggatgtgatc
gtgcgggtggcaaatggtgaacggattggaacgtacttcccggcgacaacctcacatcct
gatgctcgccaacgttggattttggccgaaaccgtgcgccattccaggattgtgattgat
gaaggggctgcaatggccctgatccagtatgggaagagtttgttggctgccggtattcgt
gaggtaaacggtgaatttgatcgcggccaaacagtacgcattttcgacctcgccgggcga
gagattgcacgcgggttgacccagtatcgttcgagtgatcttcgcctgatcgccggatta
cgctcgcaccagattggtccagttttagggtatgattacgggccagagatcgtccatcgt
gacgatatggtggtgttagcgacaaaggagtag

DBGET integrated database retrieval system