KEGG   Chloroflexus aggregans: Cagg_2300Help
Entry
Cagg_2300         CDS       T00824                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cag  Chloroflexus aggregans
Pathway
cag00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
cag01130  Biosynthesis of antibiotics
cag01230  Biosynthesis of amino acids
Module
cag_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cagg_2300
Enzymes [BR:cag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cagg_2300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG QRPTase_C NanE
Motif
Other DBs
NCBI-ProteinID: ACL25179
JGI: Cagg2300
UniProt: B8GDB2
Position
complement(2802611..2803432)
Genome map
AA seq 273 aa AA seqDB search
MREPSILEQILAHKRLEVRRQQAKIPLAVLREKVHRAPPVRDFAAALRRTPSTALIAEVK
KASPSRGVLLTDFDHLALARTYVANGAAAISVLTDQRFFQGSLMYLTGIRKLPEVQQVGT
PLLRKDFIIDPYQVYEARAYGADALLLIVAALDDELLRDLFALTYELGMHALIEVHTIAE
LERALSLHPPIIGVNNRDLHRFVTERTTTKMIADALPPPPHRPLLVSESGIFTPEHVAEV
RSYGADAILVGEALVTAGDIGAQVRALATASTR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaccatctatccttgaacagattttggcccataaacggcttgaggtccgccga
cagcaggcgaaaatccctttagcagtactgcgtgagaaagttcatcgggcgccaccggtg
cgcgattttgcggcagccctccgtcgtacaccgagtaccgcgctgattgccgaggtaaag
aaagcatcgccgagtcggggggtattgctcaccgatttcgaccatctggcgctcgcccgc
acttacgtggcaaatggcgccgccgcgatttcggtccttaccgaccagcgcttctttcag
ggcagtttgatgtatctaaccggcatccgcaagctccctgaagtgcaacaggtcggtaca
ccgctgctgcgtaaggattttattatcgatccgtaccaagtctacgaagcacgcgcttac
ggcgccgacgccctactgctgatcgtcgctgcgcttgacgatgagcttctccgcgatttg
tttgctctcacatacgagcttggtatgcatgcgctgatcgaggtacatactatcgccgaa
cttgaacgcgcgttatcgctccatcctccgatcatcggcgtgaataaccgcgatctgcat
cgttttgtcaccgaacgaacaacgacgaagatgattgccgacgctttacctcctccaccg
caccgtccattactggtgagcgaaagtggaatctttacgccagaacacgttgccgaagtg
cgtagctatggcgccgatgccatcctggtcggtgaagcattggtgacggcaggtgatatc
ggtgcacaggtgcgagcgttggcaaccgcatccacaaggtga

DBGET integrated database retrieval system