KEGG   Chloroflexus aggregans: Cagg_2553Help
Entry
Cagg_2553         CDS       T00824                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cag  Chloroflexus aggregans
Brite
Enzymes [BR:cag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Cagg_2553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3108026..3108811
Genome map
AA seq 261 aa AA seqDB search
MTEPYLLPRGNHACLLIHGFVGDPGEMRSLADYLAEAGLTVLGVRLPGHTGHPEDLMAVS
WRDWLAAVRQAFDWLTDCYATVSVIGFSLGGALAALLAAERPVHRLVMLATPYRLGGDWR
IDVLGVARYVVPWFYLLAQADFSSPDLRASIWRRQPDLDLDDPAIQQMLRRSIKVSVAAI
DELRLALAATRRVLPEVRTPVLIVHGRDDNTADPASASAIAARIGGVRCEIVYYPATGHQ
LLLTGPHRQMIFHRIGRFLSR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaccgtatttgctgccacgtggcaaccatgcctgcttactgatccatggtttt
gtcggtgaccctggtgagatgcgcagcctcgctgattatttagctgaggctggtcttact
gtgcttggtgtgcgtctacccggccacaccggccatcccgaagacttgatggcggtcagt
tggcgtgattggcttgcggctgtgcggcaggcatttgattggttgaccgactgttatgct
accgtttcggtgattgggttttcgctcggcggggcgttggctgccctgcttgccgccgaa
cgaccggtgcatcggttggtgatgttggcgacaccgtaccgcctcggtggcgactggcgg
atagacgtgttgggtgtggcgcgttacgttgtgccgtggttttatctgttggcgcaagcc
gatttttctagtcccgatctgcgggcttccatttggcgacgacagcctgaccttgatctc
gatgatccggcaattcagcagatgttacgccgatcgattaaggtgtcggtggcagcgatt
gatgaattacgcctggcgttggcagcaactcggcgtgtgctaccggaagtacgaacaccg
gtgttgatcgtccacggtcgagatgataatactgctgacccggcaagtgcttcagcgata
gcggcacggatcggtggcgtgcgttgcgagatcgtctattatccggcgaccggccatcaa
ctgttgctgaccgggccgcaccggcagatgatttttcaccggattggccggtttttgtca
aggtaa

DBGET integrated database retrieval system