KEGG   Chloroflexus aggregans: Cagg_2558Help
Entry
Cagg_2558         CDS       T00824                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cag  Chloroflexus aggregans
Pathway
cag00520  Amino sugar and nucleotide sugar metabolism
cag00550  Peptidoglycan biosynthesis
cag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cagg_2558
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cagg_2558
Enzymes [BR:cag01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Cagg_2558
Peptidoglycan biosynthesis and degradation proteins [BR:cag01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Cagg_2558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ACL25427
JGI: Cagg2558
UniProt: B8G425
Position
3114416..3115708
Genome map
AA seq 430 aa AA seqDB search
MDHFVIEGGYRLSGSIRPAGNKNAALPLLAASLLTDKPVTLRNIPDIGDVRTKLALLNNL
GVQIEQPAPNVVQLHAAHLAKHDPDVALARRIRTSPLLAGPLLFRRGYVTLPRPGGDAIG
RRRLDTHLLALQALGVHVEVTPTSYILTTEGLRGADLFLDEMSVTGTEQAIIAASVAEGH
TTIANAASEPHVQDLCHFLNQMGARISGIGTNLLEIEGVSRLRGADYTIGPDFMEVGSLI
GLAAVTRSELRIVDARPREHRMTRIMFGRLGVTWREEGNDIIVPADQELVVRHDLHGAIP
KIDSAPWPGFNPDLISTAIVIATQAQGTVLIHEKMFESRLFFVDRLIGMGARIVLCDPHR
VVVVGPSQLYGEPDGLPSPDIRAGMALVTAALCAKGRSVIYNIGQIDRGYERIEERLAAL
GARIKRVRSS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggatcattttgtgattgaaggggggtaccgactgtccggttcgatccggccggccggc
aacaagaatgccgccctcccgttacttgccgccagtttattgaccgataagccggtaacg
ttgcgtaacatcccggatatcggtgatgtgcgcaccaaacttgcgttactgaacaacctt
ggtgttcagattgagcaaccggcaccgaatgtggtgcaattgcatgccgctcacctggcc
aaacacgaccctgatgttgcgctagcccgtcgtatccgtacctcacccctgttagccggt
ccgctcttgtttcggcgtggctacgtcacattaccgcgtcccggcggagatgcaatcggt
cggcggcggctcgatacccacttgctggcgttacaggcattgggtgtgcatgttgaagtg
acgccaaccagctacatcttgacaaccgaagggttgcgcggcgctgacctgtttctcgat
gagatgagcgtgaccggtaccgagcaagcgatcatcgctgcttcagttgccgaaggacat
accacgattgccaacgcggcttctgagccacacgtccaagatctctgtcattttctcaac
cagatgggggcgcggatcagtggtatcggcaccaacctgctcgaaatcgagggggttagc
cgtttacgcggggcggattacacgatcggacccgactttatggaggtagggtcgctgatc
gggttggcagcggtcacccgtagtgaattgcggatcgttgatgcgcggccacgtgagcat
cgcatgaccaggattatgttcgggcgcctgggagtgacgtggcgtgaagagggtaacgac
attatcgttcccgccgatcaagagttagtcgtgcgtcatgatcttcacggggcgatccca
aagatcgattcggcgccatggcccggctttaaccccgacctgatcagtacggcaattgtg
atcgccacgcaagcacaggggaccgtcttaattcacgagaagatgtttgagagccgtctg
ttttttgttgaccggctgatcggcatgggggcgcggatcgtgctctgcgatccgcaccga
gtggttgttgtcgggccatcgcagctctacggcgagccagatgggttacccagcccggat
attcgggccggcatggccttggtaacggcggcgctgtgtgcgaaggggcgaagtgtcatc
tacaacattggtcaaatcgaccgcggctacgagcggatcgaagagcggttagctgctctt
ggtgcgcggatcaagcgagtgcggtcgtcgtag

DBGET integrated database retrieval system