KEGG   Chloroflexus aggregans: Cagg_2655Help
Entry
Cagg_2655         CDS       T00824                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
cag  Chloroflexus aggregans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Cagg_2655
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cagg_2655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3250936..3251370
Genome map
AA seq 144 aa AA seqDB search
MNRTIAWAFTLLLIGLLTACGGNQQTSSSAPVTELPAALADTSLSSKGDPKRGKELFGPC
AACHTTSKEVLVGPGLAGLFSASGPVLPKGVDYNGMLPNGKERSEANIAEWIRTGGTGRI
GYMPSHNLTDQEMADLLAYLRTLK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcactatcgcatgggcgtttactctgctgttgatcgggctgttgaccgcttgt
ggcggtaaccaacagacctcctcgtcggcgccggtgaccgaattgccggcggcgttggcc
gatacgtcgctttcatcaaaaggtgatccgaagcggggaaaggaactgtttggtccctgt
gcggcctgtcataccacctctaaagaagtgctcgtcggtcccggtttggccggtctgttt
agcgcctctgggccggtgttgccgaagggtgtagattataatgggatgttgcccaatggc
aaagagcgcagcgaagcgaatattgccgagtggattcgtaccggtggcaccggtcggatc
ggctatatgccttcgcacaatctgaccgatcaagagatggccgatctgctcgcctatttg
cgtaccttgaaataa

DBGET integrated database retrieval system