KEGG   Chloroflexus aggregans: Cagg_2702Help
Entry
Cagg_2702         CDS       T00824                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cag  Chloroflexus aggregans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cagg_2702
   01230 Biosynthesis of amino acids
    Cagg_2702
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cagg_2702
   00030 Pentose phosphate pathway
    Cagg_2702
   00051 Fructose and mannose metabolism
    Cagg_2702
   00052 Galactose metabolism
    Cagg_2702
  Energy metabolism
   00680 Methane metabolism
    Cagg_2702
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cagg_2702
Enzymes [BR:cag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cagg_2702
Protein phosphatases and associated proteins [BR:cag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cagg_2702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3307833..3310076
Genome map
AA seq 747 aa AA seqDB search
MTNTPIRIGVLTSGGDAPGMNAAVRAVVRTGISHGCEVYAIYEGYKGLIQGGTLIRRMDW
SSVGGIIQRGGTIIGTARSAEFRTREGRRQAAANLVTLGIDRLVIIGGDGSLTGADLFRR
EWPELLAELVAAGTISEAQAAAHPHLRIAGIVGSIDNDFCGTDMTIGADTALHRITEAID
AISSTAASHQRTFVIEVMGRNCGYLALMGAIAGGADWAFIPEMPPQMDDWEQHMCDVLRI
GREHGRRDSIVVVAEGACDRHGKPITAHYVKKVLEERLGEDTRVTILGHVQRGGAPSAFD
RWMSSLLGATAVEELLNADADAEPKLIGLRENRVVRLPLMTCVSDTRQVAEAIAQHDYER
AIAMRGNSFVEAYRTLGTLIQSQPSPPDRLRRGHRFAVMHSGGPAPGMNTAVRAAVRIGI
DRGHTMLGVRNGFQGLIDGDIFEMDWMSVSGWATMGGAELGTNRKIPQGSELYQIARNIE
RFGIDGILMIGGWAGYQAAYKLYSERHIFPAFNIPIICLPATIDNNLPGSELSLGADTAL
NSIVHAVDRIKQSAVASRRCFIVEVMGRDCGYLALMSGLATGAERVYLPEEGINLRTLQS
DLDEMMEWFRRGKRLSLIIRNEKANPIYTTSFICSLFEEEGGKLFEVRQAILGHLQQGGD
PSPFDRIQATRLAVRCIEFLIEHADRQEPVGAFIGYRGGKVQVHPIEDMPRLMDPVHARP
REQWWLALRQMTRLLTTPPVFHQVEQK
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacacacctattcggattggagtattgaccagcggtggcgatgcaccaggcatg
aatgccgcagtacgcgcggtggtccgtaccggaattagtcacggctgcgaagtatacgct
atctacgagggatataagggtctgatccaaggcggcacgttgatccgacgaatggattgg
agttcggtcggtgggattatccagcgcggggggacgatcatcgggacggcgcgcagtgct
gagttccggacgcgagaaggacgacggcaggcagcggcgaatctggtgacactcgggatt
gaccgattggtgattatcggtggtgatggcagcttgaccggggccgatctttttcgtcga
gagtggccggagttgttggccgagttggtagcggcgggtacgattagcgaagcccaagcg
gcggcgcatccgcatttacgcattgccgggattgtggggagcatcgacaatgatttctgt
ggcaccgacatgactattggtgccgataccgctctccaccggattaccgaggcgattgat
gcaattagctcaacggcagccagccatcagcgtacctttgtgatcgaagtcatggggcgc
aattgtggctatctggcgctcatgggagcgattgccggtggcgccgattgggcgtttatc
ccagagatgccaccgcagatggacgactgggagcagcacatgtgtgatgtgttgcggatc
gggcgtgagcatgggcggcgcgatagcattgtagtggtggctgaaggtgcgtgcgatcgt
cacggtaagccgattacagctcactatgtcaagaaggtccttgaggagcgcttaggtgag
gatacgcgcgtgactattctcggccacgtgcaacgtggtggtgcgccgagtgcatttgat
cgctggatgagttcgttgttgggagcaacagccgttgaagagttgctgaacgcggatgcc
gatgctgagccgaagctgatcggtttgcgggaaaatcgggtcgtgcggttgccgctcatg
acgtgcgtgagcgatacgcggcaggtggctgaggccattgctcaacacgattatgagcgg
gctatcgcgatgcgtgggaatagttttgtcgaggcgtatcgtacccttgggaccctcatc
cagtcccagccctcgccccccgaccgcttgcggcgcggtcaccggttcgctgtgatgcac
agtggtggtccggcgccgggaatgaataccgcggtccgggcagcagtacggatcgggatt
gatcgcggtcatacgatgcttggggtgcgtaacggctttcagggcctgatcgatggcgat
atctttgaaatggactggatgagtgtcagtggttgggcgacgatgggcggcgccgaactc
ggtaccaatcgtaagattccccaagggagcgaactgtaccaaatcgcgcgcaatatcgaa
cgattcgggatcgatgggatcttgatgatcggtggttgggccggttatcaggcagcgtac
aaactctacagcgagcggcatatttttccggcgttcaatattcctatcatttgcttgccg
gcaacgattgataacaatctacccggttctgaacttagcttgggggccgatacagcactc
aatagcatcgttcatgcggttgatcggattaagcaatcggcggtggcctcccggcggtgt
tttattgtcgaggtgatggggcgcgattgtgggtatcttgcgctgatgagcggtctcgcc
accggcgccgaacgggtctatctgcctgaagaggggattaacttgcgcacgttgcaatcc
gatctcgatgagatgatggagtggttccgacgtggtaaacggttgagtctgattatccgc
aacgagaaggctaatccgatctatacgacctcgtttatctgctcactgtttgaagaagag
ggcggcaagctgtttgaggtgcggcaggcaattctcggtcatttgcagcagggtggtgat
ccatcaccgtttgatcggattcaggcaacacgcctggccgtccgctgtattgagtttctg
atcgagcatgccgatcggcaggagccggtgggtgcttttatcgggtatcgtggcggtaag
gtgcaggtgcatccaattgaggatatgccgcggctgatggatccggtccatgcgcgtccg
cgtgagcagtggtggttggcgttacgccagatgacgcggttgctaacgacgccgccggtg
tttcatcaagttgagcagaagtga

DBGET integrated database retrieval system