KEGG   Chloroflexus aggregans: Cagg_2723Help
Entry
Cagg_2723         CDS       T00824                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cag  Chloroflexus aggregans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cag00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cagg_2723
Enzymes [BR:cag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cagg_2723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3345202..3347376
Genome map
AA seq 724 aa AA seqDB search
MPQLDGILERITFQSESDGYTVARLRPTGKHSTITIVGKLLGVRPGEHLILEGEWRDHPI
HGRQFSVQSYRSYLPATIDGIRRYLGSGLIKGVGPAMAKRITETFGKYTLDVLDREPERL
SEVPGLGRKKAALIAAAWREQQRIKDLMILLQDFGLPTGIAVRIYKHYGDDALSIVQHEP
YRLADEVDGVGFRTADTIAVGLGIARDDPRRIAAGLRYALGQASNAGHCYLPRLELIERA
AALLTVSQAQVVAVLDTLLANNLLWRDTVVTATDPDLQPIYLPPLAFAEIGVANAIRRFL
AQRTALAERYASSRWEKVFAHLAERRGLLLSPQQQQAVRTALTTPVMLLTGGPGTGKTTS
LRALVILLLARGYRPLLAAPTGRAARRLSEATGVEARTIHRLLEYGADGSFRRNAEYPLE
CDLLVIDEASMLDVVLANQLLKAVQPDTHLLIVGDADQLPSVGPGRVLGDLIDSGIVPRI
HLDAIFRQAAGSGIATNARRINDGLLPDWGGHDDFYFFAAETPERCAELVVELVVERIPR
RFGYDPRRDIQVLSPTHKGVAGVAALNTALQAALNPPRPGVAEYHRGDTIFRVGDRVIQQ
RNDYERDVYNGDTGEVIAIDATAPTVVVRFEDGRAIRYSSLDLDDLTLAYALSVHKSQGS
EYPVVVLPLLLQHQPLLQRNLLYTAVTRARQLVVIVGDRRAVAAAVAAAEVERRYTGLSV
RLRE
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaacttgatggcatcctcgaacggattacttttcagagtgagagcgacggttac
accgttgcgcgcttacgcccgaccggtaaacacagtaccatcacgattgtcggtaaattg
ctcggtgttcgacccggcgagcacctgatcctagagggtgagtggcgtgatcacccaatc
catggacgccagtttagtgtgcagtcctacaggagctatctcccggctacgattgacggt
attcgccgttatttggggagtgggttgatcaaaggggtgggtccggcgatggcgaaacgc
atcaccgaaacgttcggcaaatacaccctcgatgtccttgaccgcgaaccagaacggcta
agcgaagtaccgggtttggggcgtaagaaggcagcattgatcgccgcggcatggcgagag
caacagcggatcaaagacctgatgatcctcttgcaagactttggtttaccgaccgggatc
gcggtacgtatctacaagcattacggtgatgatgcactgagtattgtccaacacgagccg
tatcggttggcagatgaagttgatggagtggggtttcgtaccgccgacaccatcgccgtc
ggtctcggcattgctcgcgacgacccacgccggattgcggctgggttgcgctatgctttg
gggcaagcttccaatgcagggcactgttatctgccccggctagaactcatcgagcgtgcc
gctgcacttctgacggtgtcgcaggcgcaggtggtggcggtgcttgacacattgttggcg
aataacctgttgtggcgcgatacggtcgtcaccgctaccgatccggatctccagccgatc
tacctcccaccgttagcatttgccgaaatcggtgtcgcgaacgcgatccgtcgtttcctg
gcgcagcgcacagcactggctgaacgctacgcctctagtcgatgggaaaaagtctttgcc
catctcgccgaacggcggggcttgctgctcagtcctcagcaacagcaagcggtgcgcacc
gcgttaacaacaccggtgatgctcctcaccggcggaccgggcaccggcaaaaccaccagc
ttgcgtgcgctcgtgatcttacttctcgcccgtggctaccgcccgttactggccgcacca
accggacgggctgcccgtcggttgagtgaagccaccggggtcgaagcgcgcaccatccac
cggctgttggaatatggcgctgacggttcatttcgtcggaatgccgaatacccgctcgag
tgcgatctgctggtcattgacgaagcgagtatgctcgacgtagtactggccaatcaacta
ctgaaagcggtgcaacccgatacacaccttctcatcgtcggcgacgccgaccaactaccg
agcgtcgggccgggccgtgtgctcggcgatctgattgacagcggcatagtgccgcgtatc
catctcgacgccatcttccgccaagctgccggcagcggcattgcgactaacgcgcgacgc
atcaacgacggcctgctgccagactggggcgggcacgatgacttctacttctttgctgcc
gagacacccgaacgctgcgctgaactcgttgtcgaactggtggtcgaacgcatcccgcgc
cggttcgggtatgacccgcgacgcgacattcaagtactcagcccaacccataaaggggtt
gccggtgtagccgcactcaacaccgcgctgcaagctgcactcaacccgccgcgccccggc
gtggctgaatatcaccgtggtgataccatctttcgggtcggtgaccgcgtcattcaacag
cgcaacgactacgagcgcgatgtctataacggcgacaccggtgaagtgattgccatcgac
gccacagcgccgaccgtggtggtgcggtttgaagatgggcgcgctatccggtacagcagc
ctcgaccttgacgacctcaccctcgcttacgcactcagcgtgcataaaagtcagggcagt
gagtatccggtggtggtgctgccgctcttgctccaacatcaaccgttgctgcaacgcaac
ctgctttacaccgccgtcacccgcgcccgccagcttgtggtcatcgttggcgaccggcgc
gccgtcgctgccgccgttgccgccgctgaagtcgaacggcgttacaccggcctcagtgtg
cggctacgcgagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system