KEGG   Chloroflexus aggregans: Cagg_2808Help
Entry
Cagg_2808         CDS       T00824                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cag  Chloroflexus aggregans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cagg_2808 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cagg_2808 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cagg_2808 (trpA)
Enzymes [BR:cag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cagg_2808 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3447349..3448152
Genome map
AA seq 267 aa AA seqDB search
MNRITETFARLRSSGRIALMPYLTVGFPERESTLELVPALEAAGASLFELGIPFSDPLAD
GATIQRATQRALENGVTIADCITTVAQLRARNVKAPLLLMGYYNPLLRYGLERACAELAA
AGGDGWIIPDLPLEEAAELRPIAAAHHLDLIMFIAPTTPPTRITQIVAHASGFLYIVSLT
GVTGARQTLAANLADLITTVRQQTDLPLVVGFGISQPSHVAEVARLADGAIVGSALIDRL
ERLAPSERVSGATAYIRELVSATERVH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcattaccgaaacctttgcccgcctacgatcatctgggcgaatcgccctgatg
ccatacctgacggttggttttcccgaacgggaaagcacgcttgagttggtgccggcgttg
gaagcggcgggagccagtctgtttgaactgggcatccctttctcggatccattagccgat
ggtgcgaccatccagcgcgcgacgcagcgtgcgctggagaacggagtaacgattgccgat
tgtattactacggtggcccaactacgcgcccggaatgtcaaggctccgttgctcttaatg
ggctactacaatccgttgttacgttatggcctcgaacgggcttgcgccgagttagccgct
gccggtggtgatggttggatcattcccgatctgccgcttgaggaggcggctgagttgcgc
ccgatcgcggctgcccaccatctcgatctcattatgttcattgcgccaaccacaccgccg
acccggatcacgcagattgtggctcacgcgagtggctttctctatatcgtgtcgttgacc
ggtgttaccggtgcccggcagacgttagctgctaaccttgccgatctgatcaccacagta
cgtcaacaaaccgatctgccgctcgtggtcggttttggtatcagccagccgtcccatgtc
gcggaggtggctcggttggccgacggggcaattgtggggagtgcgttgatcgaccggctt
gaacggttggccccatcggagcgggtatccggtgctacggcctacatccgtgaattggtg
agcgcgaccgaacgtgtacattag

DBGET integrated database retrieval system