KEGG   Chloroflexus aggregans: Cagg_2808Help
Entry
Cagg_2808         CDS       T00824                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cag  Chloroflexus aggregans
Pathway
cag00260  Glycine, serine and threonine metabolism
cag00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
cag01130  Biosynthesis of antibiotics
cag01230  Biosynthesis of amino acids
Module
cag_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cagg_2808
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cagg_2808
Enzymes [BR:cag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cagg_2808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG PcrB BtpA
Motif
Other DBs
NCBI-ProteinID: ACL25670
JGI: Cagg2808
UniProt: B8G5G4
Position
3447349..3448152
Genome map
AA seq 267 aa AA seqDB search
MNRITETFARLRSSGRIALMPYLTVGFPERESTLELVPALEAAGASLFELGIPFSDPLAD
GATIQRATQRALENGVTIADCITTVAQLRARNVKAPLLLMGYYNPLLRYGLERACAELAA
AGGDGWIIPDLPLEEAAELRPIAAAHHLDLIMFIAPTTPPTRITQIVAHASGFLYIVSLT
GVTGARQTLAANLADLITTVRQQTDLPLVVGFGISQPSHVAEVARLADGAIVGSALIDRL
ERLAPSERVSGATAYIRELVSATERVH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcattaccgaaacctttgcccgcctacgatcatctgggcgaatcgccctgatg
ccatacctgacggttggttttcccgaacgggaaagcacgcttgagttggtgccggcgttg
gaagcggcgggagccagtctgtttgaactgggcatccctttctcggatccattagccgat
ggtgcgaccatccagcgcgcgacgcagcgtgcgctggagaacggagtaacgattgccgat
tgtattactacggtggcccaactacgcgcccggaatgtcaaggctccgttgctcttaatg
ggctactacaatccgttgttacgttatggcctcgaacgggcttgcgccgagttagccgct
gccggtggtgatggttggatcattcccgatctgccgcttgaggaggcggctgagttgcgc
ccgatcgcggctgcccaccatctcgatctcattatgttcattgcgccaaccacaccgccg
acccggatcacgcagattgtggctcacgcgagtggctttctctatatcgtgtcgttgacc
ggtgttaccggtgcccggcagacgttagctgctaaccttgccgatctgatcaccacagta
cgtcaacaaaccgatctgccgctcgtggtcggttttggtatcagccagccgtcccatgtc
gcggaggtggctcggttggccgacggggcaattgtggggagtgcgttgatcgaccggctt
gaacggttggccccatcggagcgggtatccggtgctacggcctacatccgtgaattggtg
agcgcgaccgaacgtgtacattag

DBGET integrated database retrieval system