KEGG   Chloroflexus aggregans: Cagg_3054Help
Entry
Cagg_3054         CDS       T00824                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cag  Chloroflexus aggregans
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Cagg_3054
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cagg_3054
Enzymes [BR:cag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Cagg_3054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3714254..3715786
Genome map
AA seq 510 aa AA seqDB search
MPKTLADLLSGVSVYHLIGDPATPISALVYDSRRVTPGSLFVAIRGQHSDGHNFIPQAIA
AGAAAVVVDQRYWHGAVSAEVPVVVVADSRVALAPLAAAFYEYPGQQLTTIGITGTKGKS
TTTDLTAQLLAAAGRTVGMISTVDFQIGTRRWPNDTRQSTPEAPEVQALLREMVVAGCDT
AVIEATSHALSPRWGRLVGCAFAVAVMLNIGHEHLDFHGTFEQYRADKAQLFALLAERHG
PTWAIVNADDPHHGTFLAAVPSQTMRLRYALHAPADVQGQIVHSGPASSHMRIHSPWGEI
EVNVPLPGRFNASNVLAALTVALTQGVPLERAAAAVAHVRAPRGRMVSINVGQPFTVIVD
YAHNPDSFEQIFTMLRPQVTGRIIAVFGSAGERDVSKRAIQGEIAGRMCDLLVLTDEDPR
GEDREAIIAQIAAGAERAGKRPGSGYLCIPNRAQAIRTAIAAARPGDMVLLLGKGHEGSI
IYADYTLPWDEEGEARRALAELGYHAKEQA
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaacactcgccgatttgttgtctggggtatccgtgtaccatctgatcggtgac
cctgctacgccgatcagtgctcttgtctacgactcgcgccgggtgacgccggggagtctg
tttgtcgcgattcgtgggcagcacagcgatggccataactttatcccacaagcgattgct
gccggagcggcagcagtggtcgtcgaccagcggtactggcatggtgcggtgtcggctgaa
gtgccggtcgtggttgttgccgacagtcgggtggcgctggcgcctttggctgccgccttt
tacgagtatccggggcaacagttgacgaccatcgggattaccggcaccaaagggaagagt
acgaccaccgacctgacggctcagctcttggctgctgctgggcgtactgtaggaatgatc
agtacggttgattttcagatcggtacgcggcgctggccgaatgacacccgccaaagtaca
ccggaagcgccagaagtacaggccctcttgcgcgaaatggttgtcgccgggtgcgataca
gccgtgattgaggctacttctcacgccctctcgccgcgttgggggcggttggtgggttgt
gcctttgcggtggcggtgatgctcaacatcggtcacgaacatctcgattttcacggtacc
tttgagcaataccgggccgacaaagcccaactctttgccctgcttgccgaacgtcatggc
ccgacgtgggctattgtgaacgccgatgatccacatcacggcacgttcctggctgctgta
ccgtcgcaaacgatgcgattacgctatgccttgcacgctcccgccgacgtgcaaggtcag
attgtccacagtgggccggcaagtagccacatgcggatacattcaccgtggggcgaaatt
gaagtgaacgtgccgcttcccggacgtttcaatgccagtaacgtactggccgcactcacc
gttgcccttacgcagggtgtgccgctcgaacgtgctgctgccgctgtcgctcatgtccgt
gccccacgcgggcggatggtgtcgatcaatgtcggtcagccgtttaccgtaatcgtcgat
tacgcgcataatcccgattcgtttgagcaaatcttcaccatgcttcgcccacaggtgaca
ggtcgaataatcgctgtgtttggaagcgccggcgagcgcgatgtgagcaaacgcgccatt
caaggcgagattgccgggcgtatgtgtgatttgctcgtgttgaccgatgaagacccgcgt
ggcgaagatcgtgaggcgatcattgcccagatcgctgccggcgccgaacgagccggtaaa
cgacccgggagtggttacctttgtattcccaaccgggcacaagcgataaggacggccatc
gctgccgctcggcccggtgatatggtgttgctgttaggcaaaggtcacgaaggtagtatc
atctacgccgattatacgctgccgtgggatgaagaaggtgaagcgcgacgggcgctggcc
gaattaggctatcatgctaaagagcaagcatga

DBGET integrated database retrieval system