KEGG   Chloroflexus aggregans: Cagg_3122Help
Entry
Cagg_3122         CDS       T00824                                 

Definition
(GenBank) magnesium chelatase ATPase subunit D
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cag  Chloroflexus aggregans
Pathway
cag00860  Porphyrin and chlorophyll metabolism
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cagg_3122
Enzymes [BR:cag01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cagg_3122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 VWA AAA_5 VWA_CoxE VWA_3 Mg_chelatase MCM Sigma54_activat AAA_25
Motif
Other DBs
NCBI-ProteinID: ACL25980
JGI: Cagg3122
UniProt: B8G7E5
Position
complement(3782184..3784094)
Genome map
AA seq 636 aa AA seqDB search
MVQRVKELPTGPLPFTAIVGLEAARQALLLLAVDPLLTGVAIGAGAGTGKSALVRAFARM
LAGGREFDPTLPCNLVEMPVGVSEDRLLGGIDIEATLALGERVHRSGLLARANGGLLYVD
SVNLLDDSTINHILGALDSGVVRVEREGISVVEPARFVLLVTYDPAEGPPRRHLLDRLGL
IVAPIGKAPVTTRAEVVRRNLQPHLDYEDDEALVLAGILAARELLPNVTITDDQIRQLSL
TALALGIEGHRADMFAVRAARAAAALAGRDEVSNEDLELAVRLVMLPRATRLPEMTPAES
QPPPPTPEPAPPPPSQQQEDDEQNNDDDQPPTPPDEELTVEDLILAAMETEVPPDILETP
FTVRRRGRSGSRGTISGQRGRHIRSVPGNPAQGRLDVIATLRAAAPWQRLRASDHPPHQH
RRGRIHLRAEDLHIKKYRSKAGTLFCFLVDASGSMALHRMRQAKGAVNSLLQQAYVHRDQ
VALLAFRGERADLLLPPSQSVELAKRALDVLPTGGGTPLAAALLAAYQISEQARARGIFR
TTIVLITDGRPNVPLKADPTMDKNRRLEQARQEVQQLAGRLRAAGVGAVVIDTQRSFVSR
GEAQQLAVWLGGRYVYLPNGRGDQIANAVIAASEEM
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaagagtgaaagaactaccgacagggccacttcccttcacggcaatcgtcggc
ctcgaagcagcccgacaggccctgctcctgttggcagtcgatccgctgctgaccggtgtc
gcgattggtgcaggagcaggtaccggtaaaagtgcgttggtgcgcgcctttgcccgtatg
ctggccggtgggcgtgagtttgaccccaccttaccctgcaatttggtcgagatgccggtc
ggcgtaagcgaagaccgactcttgggtggaattgacatcgaagcaactctcgcgttgggc
gaacgggtccatcggagtggcctcctcgcgcgcgccaacggcggcttgttgtacgttgat
agcgtcaacttgctcgacgatagcacgatcaaccacattctcggtgcgttggatagcggc
gtggtgcgggtcgagcgagaaggaatatccgttgtggaaccggcccgttttgtgctgctc
gtcacatatgacccggcggaggggcctcctcgtcgccatttgctcgaccgcctagggttg
atcgtagcgccgatcggtaaagccccggtgacgacgcgggccgaggttgtgcgtcgcaac
ctccaaccccacctcgattacgaagatgatgaggcgctggtgttagccggcattctggcg
gcacgtgaactgttacccaacgtcaccatcaccgatgatcagattcggcaattgagtctg
acagccctagccctaggaatcgaagggcatcgggccgatatgttcgcggtgcgggcagca
cgggcagcagccgccctggccggacgtgatgaggtgagtaacgaagaccttgagctggcc
gtgcggttggtgatgctgccgcgtgctacacggctaccagaaatgacaccggcagaatct
caaccaccaccaccaaccccagaaccggccccaccaccaccgagtcagcaacaagaagac
gacgagcagaacaacgatgacgatcaaccaccgacgccaccagacgaagagttgacggtc
gaggatctcatcctggccgcaatggagacggaagtaccgccggacatcctcgaaacgccg
tttaccgtgcgccgacgcgggcggagtggttcacgtggcaccatttccggacaacgcggt
cgccatattcgctcggtaccggggaatccggctcaagggcggctcgatgtgattgccaca
ctccgtgccgccgcaccgtggcaacggctacgagcaagtgaccatccgccacatcagcat
cggcgtggacgcattcacttgcgtgccgaagacttacacatcaagaaataccgttctaag
gcggggacactcttctgttttctggttgatgccagcggttcaatggctctgcaccgcatg
cgacaggcgaaaggcgccgtcaattccctcttgcagcaagcctacgttcaccgcgatcag
gtggcgttgctggctttccgtggtgagcgggccgatctgctccttcctccatcacaaagt
gtcgaactggccaaacgcgccctcgacgtgttgccaaccggtggaggaaccccgctcgca
gcggcgctattggcggcgtaccagatcagtgagcaagcacgggcacgtggtattttccgc
actaccatcgtgctgatcaccgatgggcgaccgaatgtaccgcttaaggccgatcccacg
atggacaaaaatcgccggcttgagcaagctcgtcaagaggtacagcaactagccggtcgg
ctgcgcgctgccggtgtcggtgctgtggtcattgatacccagcgcagtttcgtttcacgg
ggtgaagcccagcaattggcggtatggctcggtgggcgctacgtatatctgccaaatgga
cgaggggatcagattgcaaatgccgtcattgcggccagcgaagagatgtag

DBGET integrated database retrieval system