KEGG   Chloroflexus aggregans: Cagg_3123Help
Entry
Cagg_3123         CDS       T00824                                 

Definition
magnesium chelatase ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cag  Chloroflexus aggregans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cagg_3123
Enzymes [BR:cag01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cagg_3123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3784250..3785362)
Genome map
AA seq 370 aa AA seqDB search
MNNEHDQVVTTEEVSSNGQAPATNAPIPPYPFVAIVGQAELKLALLLCVVNPTIGGVMVM
GHRGTAKSTSVRALAAMLPPIKAVAGCPYSCAPDRPAGLCDQCRAIPAQKGKSKKLSVIN
IPVPVVDLPLGATEDRVCGTLDIERALTQGVQAFAPGLLARANRGFLYIDEVNLLEDHLV
DVLLDVAASGVNVVEREGVSIRHPARFVLVGSGNPEEGDLRPQLLDRFGLHARITTITDV
NERVEIVKRRREYDADPFAFAEKWSKETQKLQRKIKQAQRRLPDVVLPDPVLYKIAELCV
KLEIDGHRGELTLARAATALAALEGRNEVTIQDVRRIAVLALRHRLRKDPLETQDDTVRI
ERAVEEVLVP
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatgaacatgaccaggtcgtcaccacagaagaagtatcaagcaatgggcaagcg
cccgcgacgaatgctccgataccaccctacccgtttgttgccattgttggtcaagctgaa
ttgaagttagcgctgttgctttgtgtggtcaatccgacaatcggcggcgtgatggttatg
ggccaccgtggcactgccaaatcgacatcggtgcgagcactggcagcaatgctgccgccg
atcaaggcagtggccggctgcccgtattcgtgtgcaccagatcggccggccggtctgtgc
gatcagtgccgggcaattcctgctcagaagggtaaatccaagaagctgagtgtgatcaat
attccggtgcctgtcgttgatttaccactcggtgcaacagaagatcgagtgtgtggtacg
ctcgatattgagcgtgcgctgacgcaaggagtacaggcgtttgctccgggcctgctggcg
cgcgccaatcgtgggtttctttacattgatgaagtgaatttgctcgaagaccatttggtt
gatgtgttacttgatgtagccgcttcgggggtgaatgtcgtggaacgtgaaggagtgagt
atccgccacccggcacgcttcgtgctggtaggatcgggcaaccccgaagagggtgatctg
cgaccacaattactcgaccgctttggcctccatgcccgcatcacgacgatcaccgatgtg
aatgagcgggtcgagattgtcaaacggcgccgcgaatacgacgccgatccgtttgccttt
gctgagaagtggtcgaaagagacccagaaattgcagcgcaagattaagcaggcgcaacgt
cgtttgcccgatgtcgtgttacccgatccggtactctacaaaatcgccgaattgtgcgtc
aagcttgaaattgatggtcaccgtggtgagctaacattggcccgtgccgctactgctttg
gctgcattagaagggcgtaacgaggtgacgatacaggatgttcgccgcatcgcagtgctc
gcgttgcgtcaccgtctccgcaaagatccgttggagacccaagatgatactgtccgaatc
gagcgagccgtagaagaggtgttagtgccgtaa

DBGET integrated database retrieval system