KEGG   Chloroflexus aggregans: Cagg_3201Help
Entry
Cagg_3201         CDS       T00824                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
cag  Chloroflexus aggregans
Pathway
cag03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cag00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cagg_3201
DNA repair and recombination proteins [BR:cag03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Cagg_3201
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cagg_3201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 zf-P11 Prok-RING_4 HHH_8
Motif
Other DBs
NCBI-ProteinID: ACL26059
JGI: Cagg3201
UniProt: B8G7M4
Position
3885608..3886225
Genome map
AA seq 205 aa AA seqDB search
MTVHPDHYLIAAPVARLIEEFARLPGIGPKTASRLTFYLLRAEPKQAQALAQAILDVKAQ
VGYCRRCFNITVDELCPICRDPSRDQTKICVVEEPLDVLAIERTGAYRGLYHVLHGHIAP
LEGIYREDLKIDELIARVRSEPVNEVILATNPNTEGEATAFLLLRDLAPLGVRVTRPARG
LPTGGDLEWADPETLGSALEGRREL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttcacccagatcattatctgatcgccgctccggtagcccgcttgatcgaggag
tttgccaggctgcccggtattggcccgaagacagcctctcgtctcacgttttatctgttg
cgtgccgaaccaaagcaagcccaagcgcttgcccaggcaatcctcgatgtcaaagcgcag
gtgggttattgccgacgttgtttcaatattacggtcgatgagctgtgcccaatctgccgc
gacccctcacgcgatcagaccaaaatctgcgtggtcgaagagccactcgatgtactcgct
attgaacgtaccggtgcctaccgtggtctctaccacgtgttacacggtcatatcgctccc
ctcgaaggtatctaccgcgaggatctgaaaatcgatgaactcattgctcgtgtgcgcagt
gaaccggtgaatgaagtcatccttgctacgaatcccaatactgaaggggaagcaacggcg
ttcctgttgctccgcgatttagcaccgcttggggtacgagtaacgcgcccggcccgcggt
ttgccaaccggtggtgatttagagtgggccgatcctgaaaccctcgggtcagcattagag
ggcagacgggaattgtga

DBGET integrated database retrieval system