KEGG   Chloroflexus aggregans: Cagg_3402Help
Entry
Cagg_3402         CDS       T00824                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cag  Chloroflexus aggregans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Cagg_3402
Enzymes [BR:cag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Cagg_3402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4132442..4133119
Genome map
AA seq 225 aa AA seqDB search
MTTTSLTEIERALRAEMVLCGRLLYERGLIVAGDGNLSARLPDGTILMTPAGLAKGMLTT
DDLVVVDRDGRLIRGETNRQPSSERYLHLFVYQHRPDIMACVHAHPPTAVGATLAGVSLA
EPLLPEAQIALGPIPTAPYALTGTIEMGAAIAPFVADHEAILLAYHGALTYGATLMQAFH
RMEQVEHCARILLAAHLFGGARPLPPERLAELAEVRQAFRASGRV
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacttcactcaccgagattgaaagggcgctacgcgccgaaatggtattgtgc
ggtcgcctgctctatgagcgggggttgatcgtagccggtgatggtaatctctcggcccgg
cttcccgatggcacgattttgatgacgccggccggtttggccaaagggatgctgaccact
gatgatctggtcgtcgtcgatcgcgacggccggttaattcggggcgaaaccaatcgccag
ccgtcctcggaacgctatttgcatctctttgtctaccaacatcggcccgatattatggct
tgtgttcatgctcacccacctacggcggttggggctactcttgccggcgttagtttagct
gagccgttgctgcctgaagcgcagatcgcactcggtccgataccaactgcaccctatgct
ctcaccggtaccatcgagatgggagcggcaattgccccatttgtcgccgatcacgaggct
attctattagcatatcatggtgcattaacttacggtgcaacgctgatgcaggccttccac
cgaatggaacaagttgaacactgtgcgcgtatcctgctagcggcccatctgtttggtggc
gcgcggcccttaccgcccgagcgtctcgccgaattggccgaagtacggcaggcatttcgg
gcgtccgggcgtgtgtga

DBGET integrated database retrieval system