KEGG   Chloroflexus aggregans: Cagg_3643Help
Entry
Cagg_3643         CDS       T00824                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cag  Chloroflexus aggregans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cagg_3643
   01230 Biosynthesis of amino acids
    Cagg_3643
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cagg_3643
   00030 Pentose phosphate pathway
    Cagg_3643
   00051 Fructose and mannose metabolism
    Cagg_3643
   00052 Galactose metabolism
    Cagg_3643
  Energy metabolism
   00680 Methane metabolism
    Cagg_3643
Enzymes [BR:cag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cagg_3643
Protein phosphatases and associated proteins [BR:cag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cagg_3643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4429418..4430488
Genome map
AA seq 356 aa AA seqDB search
MASKKQRIGVLTSGGDAPGLNAVIRAVVKSASSLGWEVIGIHDGFEGLLGTKSYRVLTNA
DVQGLLPRGGTILRTTNKGHFGPRRSDELSEADPYVRAVKAIEEMGLRALITIGGEGTQR
IALELHKLGAPVIGVPKTIDNDLAGTDRTFGFDTALQVATDAIDRLHTTAASHNRVMVLE
VMGRHTGWIALHAGLAGGADVILIPEIPFTIERVAEKVHARDAQGSAFSIIVVAEGARPR
GGSEMYIAEGRLGGIGHWVGEQLERLTGKDVRVVVLGHLQRGGSPSPYDRLLSTRYGAAA
VQAAARGIYGEMVALRGQDIVTVPLAEACGYLNRVRPHSDLVLCARSLGIVFGDEL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtaagaagcagcggattggcgtgctcacgagcggtggtgatgcgccagggctt
aatgctgtcatccgtgcggtcgtcaagtcggcgtccagtctcggttgggaagtgatcggg
attcacgacgggtttgagggattgttggggacgaagagctatcgtgtgctgaccaacgct
gatgtccaggggttgttaccacgcggtggtacgattttgcgtaccacgaataaaggtcat
tttggcccacgccgcagtgatgaattatcagaagccgatccgtatgtacgtgccgtcaag
gcgatcgaggagatgggcttgcgtgcgctgattaccattggcggtgaaggtacacagcgg
attgccttagaactacacaagttgggcgcaccggtcattggtgtgccgaaaacgattgac
aacgatctcgccgggaccgatcgcaccttcgggtttgatactgccttacaagtagcgacc
gatgcgattgatcgtctgcacacgacagcagccagtcacaatcgggtaatggtgctcgag
gttatgggtcggcataccggctggattgcgctgcacgccggtttggccggtggggccgat
gtgatcctcatccctgagattccgtttacaattgaacgggttgcagaaaaggtgcatgca
cgtgatgcccaaggtagcgctttcagtattattgttgtcgccgaaggtgcgcgtccgcgc
ggtggtagcgaaatgtacattgccgaggggcgccttggcgggatcgggcattgggttggt
gagcaactcgaacgtctaaccggcaaagacgtccgggtcgttgtcttggggcatttgcaa
cgtggcggttcgccttcaccatacgaccgcttgctctcgacgcgctacggtgctgctgcc
gtgcaagctgcggctcgtggcatctacggtgaaatggtggcgttgcgcgggcaagatatt
gtgaccgtgccgctcgccgaggcgtgtggctatctcaatcgggtgcgtccgcatagcgat
ctggtgctctgcgcgcgcagtttgggaatagtgtttggtgatgaactctga

DBGET integrated database retrieval system