KEGG   Chloroflexus aggregans: Cagg_3643Help
Entry
Cagg_3643         CDS       T00824                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cag  Chloroflexus aggregans
Pathway
cag00010  Glycolysis / Gluconeogenesis
cag00030  Pentose phosphate pathway
cag00051  Fructose and mannose metabolism
cag00052  Galactose metabolism
cag00680  Methane metabolism
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
cag01120  Microbial metabolism in diverse environments
cag01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cagg_3643
   00030 Pentose phosphate pathway
    Cagg_3643
   00051 Fructose and mannose metabolism
    Cagg_3643
   00052 Galactose metabolism
    Cagg_3643
  Energy metabolism
   00680 Methane metabolism
    Cagg_3643
Enzymes [BR:cag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cagg_3643
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Cagg_3643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACL26479
JGI: Cagg3643
UniProt: B8GAA4
Position
4429418..4430488
Genome map
AA seq 356 aa AA seqDB search
MASKKQRIGVLTSGGDAPGLNAVIRAVVKSASSLGWEVIGIHDGFEGLLGTKSYRVLTNA
DVQGLLPRGGTILRTTNKGHFGPRRSDELSEADPYVRAVKAIEEMGLRALITIGGEGTQR
IALELHKLGAPVIGVPKTIDNDLAGTDRTFGFDTALQVATDAIDRLHTTAASHNRVMVLE
VMGRHTGWIALHAGLAGGADVILIPEIPFTIERVAEKVHARDAQGSAFSIIVVAEGARPR
GGSEMYIAEGRLGGIGHWVGEQLERLTGKDVRVVVLGHLQRGGSPSPYDRLLSTRYGAAA
VQAAARGIYGEMVALRGQDIVTVPLAEACGYLNRVRPHSDLVLCARSLGIVFGDEL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtaagaagcagcggattggcgtgctcacgagcggtggtgatgcgccagggctt
aatgctgtcatccgtgcggtcgtcaagtcggcgtccagtctcggttgggaagtgatcggg
attcacgacgggtttgagggattgttggggacgaagagctatcgtgtgctgaccaacgct
gatgtccaggggttgttaccacgcggtggtacgattttgcgtaccacgaataaaggtcat
tttggcccacgccgcagtgatgaattatcagaagccgatccgtatgtacgtgccgtcaag
gcgatcgaggagatgggcttgcgtgcgctgattaccattggcggtgaaggtacacagcgg
attgccttagaactacacaagttgggcgcaccggtcattggtgtgccgaaaacgattgac
aacgatctcgccgggaccgatcgcaccttcgggtttgatactgccttacaagtagcgacc
gatgcgattgatcgtctgcacacgacagcagccagtcacaatcgggtaatggtgctcgag
gttatgggtcggcataccggctggattgcgctgcacgccggtttggccggtggggccgat
gtgatcctcatccctgagattccgtttacaattgaacgggttgcagaaaaggtgcatgca
cgtgatgcccaaggtagcgctttcagtattattgttgtcgccgaaggtgcgcgtccgcgc
ggtggtagcgaaatgtacattgccgaggggcgccttggcgggatcgggcattgggttggt
gagcaactcgaacgtctaaccggcaaagacgtccgggtcgttgtcttggggcatttgcaa
cgtggcggttcgccttcaccatacgaccgcttgctctcgacgcgctacggtgctgctgcc
gtgcaagctgcggctcgtggcatctacggtgaaatggtggcgttgcgcgggcaagatatt
gtgaccgtgccgctcgccgaggcgtgtggctatctcaatcgggtgcgtccgcatagcgat
ctggtgctctgcgcgcgcagtttgggaatagtgtttggtgatgaactctga

DBGET integrated database retrieval system