KEGG   Chloroflexus aggregans: Cagg_3782Help
Entry
Cagg_3782         CDS       T00824                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
cag  Chloroflexus aggregans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cagg_3782
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cagg_3782
   00630 Glyoxylate and dicarboxylate metabolism
    Cagg_3782
Enzymes [BR:cag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Cagg_3782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4615108..4616706)
Genome map
AA seq 532 aa AA seqDB search
MTTPHFPAGVTITAPITPEYAEILTPEALEFLATLHRRFNARRLELLARRAERQRAIDAG
ERPDFLPETAHIRESDWTIAPFPPQLNDRRVEITGPVDRKMIINALNSGAKVFMADFEDA
NTPTWQNQIEGQINLRDALRRTITYTSPEGKYYALNPNPAILFVRPRGWHLPEKHMLVDG
EPIAGAIFDFGLYFFHNAQTAIEVQGGPYFYLPKLESHLEARLWNDIFVLAQELRGIPRG
TIKATVLIETILAAFEMDEILYELREHSAGLNCGRWDYIFSCIKKFRNDPNFCLADRVLV
TMTTHFMRSYSLLAIKTCHRRGAHAMGGMAAQIPIKNDPVANEAALAKVRADKEREANDG
HDGTWVAHPGLVPVAMEVFDRLMPTPNQINRQRDDVHVTAADLLAFGPSEPITEQGLRLN
INVGIQYLGAWLAGNGCVPVFNLMEDAATAEISRAQIWQWIRSPKGVLADGRKVTVELFR
QMLPEELAKVREILGPAYEDGRYGEAAELFDEITTDPNFVEFLTLPAYDRIP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccccactttccggccggtgtgaccatcacagcgcccatcactcccgagtac
gccgagatcctcacccctgaagctttagagttcctcgctaccctacatcgtcgctttaat
gcacgtcggctcgaattactcgcccgccgtgccgaacggcaacgagccatcgacgccggt
gaacggcctgattttcttcctgaaacggcccatatccgcgaaagcgattggacgatagcc
cccttccccccgcaactcaacgaccgccgcgttgaaattaccggtccggttgaccgcaag
atgattatcaatgcgctcaactcaggggcgaaggtctttatggccgactttgaggacgcg
aatacgccaacatggcaaaaccagatcgaaggtcagatcaatttgcgtgatgctcttcgc
cggacgattacctataccagtcctgaaggcaagtattacgcactcaaccccaatccggcg
atcttgttcgtccgcccacgcggctggcatttgccggaaaagcatatgctggtcgatggt
gagccaatcgccggtgccatcttcgattttggcctctatttcttccacaatgcacaaacg
gctatcgaggtacagggcggcccgtatttctacctacctaagctcgaaagtcatcttgaa
gcgcggctgtggaacgacatttttgtgctggcccaagaattgcgcggtattccacgaggg
acgattaaagcgaccgtgctgatcgaaacgattctggccgcgtttgagatggacgagatt
ctctacgagctacgtgaacactcagccggcctcaactgtggacgttgggactatattttc
tcgtgcattaagaagtttcgcaatgaccccaatttctgtctcgccgaccgtgtgttggtt
acgatgacaacgcactttatgcgttcgtactcgctcctcgcgattaagacttgtcatcgg
cgcggggcgcatgcgatggggggaatggccgcgcaaatcccgattaagaacgacccggtc
gcaaatgaagcagcgttagccaaggtgcgtgccgataaggagcgtgaggcaaacgatggg
catgacggtacctgggtggctcaccccggcctcgtccctgtcgcgatggaggtcttcgac
cgcctgatgcccactcccaatcagattaaccgccaacgcgatgatgtccacgtgacggcc
gccgatctgctggcctttggtccgagtgaaccgattaccgagcagggactacggctcaac
atcaatgtcgggattcaatacctcggcgcatggttggccggtaatgggtgtgtgccggtc
tttaacctgatggaagacgcggcgactgctgaaatatcgcgcgctcagatctggcagtgg
atccgcagcccgaagggagtgttggcggatggtcgtaaagtgaccgtggaactgttccgg
caaatgcttcccgaagaactggcgaaggtgcgcgagattctcggcccggcctacgaagat
ggtcgctacggagaggccgccgaactgttcgatgaaattaccaccgacccaaacttcgtt
gagtttctgacgttgccggcatatgaccgtattccgtaa

DBGET integrated database retrieval system