KEGG   Chloroflexus aggregans: Cagg_3789Help
Entry
Cagg_3789         CDS       T00824                                 

Definition
(RefSeq) acetate/CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cag  Chloroflexus aggregans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cagg_3789
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cagg_3789
   00620 Pyruvate metabolism
    Cagg_3789
   00640 Propanoate metabolism
    Cagg_3789
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cagg_3789
   00680 Methane metabolism
    Cagg_3789
Enzymes [BR:cag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cagg_3789
Lipid biosynthesis proteins [BR:cag01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cagg_3789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4623288..4625222)
Genome map
AA seq 644 aa AA seqDB search
MTETRDVALPDTGELYYPDPALVEQSNVMAYARSKGFNSYDELYQWTITHREEFWADMAG
ELEWFKPWEKVLDDSNKPFYKWFVGGKTNIVYNAIDRHLKTWRKNKLALIWEGEDGSQRT
YSYYQLNYEVSRIANVLKSMGVKKGDIVTIYMPRIPELMFSMLACAKIGAAHSVVYGGFS
EAALADRLADAKSKVLITADGGYMRGKIVELKKIVNEALARTPTVQTCLVFRHTNHGAPM
EQGRDFWMHDLLGLPIANGHCPTEEMDAEDMLFILYTSGTTGKPKGVVHTHGGYMVGTYT
TLKFVFDIKDEDRYWCAADPGWITGHSFIVYAPLINGATSFMYEGAPNYPYPDRWWSMVA
KHGITILYTAPTAIRGLMRFGDLWPSRHDLSTLRLLGSVGEPINPEAWKWFYEKIGHNRC
PIMDTWWQTETGHFMITPTPAVPLKPGSATRPFLGIEVDVVHEDGTPCAPDEDGLLVIKT
PWPGMMRTILYDPQRYVEGYWQKVPPYYAAGDSARKDKDGYIWVIGRLDDVIKVSGYRLG
TAEVESALVSHPAVAEAAAIGLPHEVKGNAIHAFVILRAGYEPSHELEEKLRAHVGHELG
PIARPDSITFVTSLPKTRSGKIMRRVLRARALGLPEGDISTLEE
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagactcgcgatgtggcgctgcccgacaccggtgaactgtactaccccgacccg
gcactggttgagcaatctaatgtgatggcgtatgctcgcagcaagggcttcaactcctac
gatgaactataccagtggacgatcacccaccgtgaagagttttgggccgatatggccggc
gaactcgagtggttcaaaccgtgggagaaggtgctcgatgacagcaacaaaccattctac
aagtggtttgttggtgggaaaaccaatatcgtctacaatgccatcgaccgccacctcaag
acgtggcgcaagaacaagctggccctgatctgggaaggtgaggatggaagccagcgcacc
tattcctattaccagctcaattacgaagtgtcgcggattgccaacgtgctgaagagcatg
ggggtgaagaagggcgatattgttaccatttacatgccccgcatccctgagctgatgttt
agcatgctggcctgtgctaagatcggcgccgctcacagcgtggtctacggcggcttttcg
gaagcggcgcttgctgaccgcttagccgatgccaagagcaaggtgctgattactgccgat
ggcggctacatgcgcggcaagatcgtcgaactgaagaagatcgtgaacgaggcgttggcc
cggactcccaccgtccaaacctgtctcgtcttccgccataccaaccacggtgccccgatg
gagcaggggcgagacttctggatgcacgatctcctcggtttgccgattgccaacggtcat
tgccccaccgaagagatggatgccgaggatatgctgtttatcctctacacatcgggcacg
accggtaaacccaaaggtgtggtacacacccacggcggctatatggtcggtacctatacg
acgctcaagtttgtgtttgacatcaaagacgaagatcgctactggtgtgccgccgaccca
ggctggattaccggccactcgtttattgtctatgcccccctaatcaacggcgctacctcg
tttatgtacgagggcgctcccaactatccataccccgatcgctggtggagcatggttgcc
aagcacggcattaccatcctctacactgccccgactgctattcgcggcttgatgcgcttc
ggcgatttgtggccctcgcgccacgatcttagcactctgcgcttgctcggttcggtcggc
gagccgattaaccctgaagcgtggaagtggttctacgagaagatcggtcataatcgctgc
cccatcatggatacgtggtggcagactgagaccggccactttatgattacaccgaccccg
gctgtaccgctaaagcccggttcggcgacccgccccttcctcggcatcgaagttgatgtg
gtgcatgaagatggtacaccctgcgcacccgatgaagacggtctgctggtgatcaagaca
ccgtggccgggtatgatgcgcacaatcttgtacgatccacagcgctatgtcgaaggctat
tggcaaaaggtgccgccgtactacgctgccggtgacagcgcacgtaaagacaaggacggc
tatatctgggtgattggccgcctcgatgatgtgatcaaggtgtcgggctaccggctaggc
accgccgaagtcgagagcgcattggtcagccaccccgccgttgccgaggccgccgcgatt
gggttgccgcacgaggtgaagggcaacgcgatccacgccttcgttattctgcgtgccggt
tacgaaccgagccacgagctggaagaaaaattgcgcgcacacgtcggccacgagcttggg
ccgatcgctcgccccgactcgattaccttcgtaacgtcgctgcccaagacgcgctccggt
aagattatgcgccgtgtgctgcgtgcccgtgcgttgggcctgcccgaaggcgacatctcg
acgctcgaagagtag

DBGET integrated database retrieval system