KEGG   Clostridium autoethanogenum: CAETHG_0129Help
Entry
CAETHG_0129       CDS       T02883                                 

Definition
(S)-3-amino-2-methylpropionate transaminase (EC:2.6.1.22)
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cah  Clostridium autoethanogenum
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cah00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cah00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cah00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:cah00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cah00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
138951..140309
Genome map
AA seq 452 aa AA seqDB search
MLKEQLPKIITDKVPGPKAEEVIRRREDAVPSAIKCVYPVVIKRAEGAVIEDVDENYFLD
WTGGVGVLNVGFSHPEVVEAVKEQSEKYFHGMFNIVTHEGYVKLAEKMNSIVPVKGNKKK
TFFANSGAEADENAVKIAKAFTNRPNIVVFSGAFHGRTVMTMAMTSKKSYAYGMGPFPDG
VYRAEFPYLYRSPEGMPESETINYYIESIKKVFDQASPPEYVAAIVVEPLQGEGGFIPAP
IEWVKAVRTICDKYGILLVADEVQCGFCRTGKMFASEYWKEAGAAPDIIATAKSIAAGMP
LSAITAREEIMEAVRPGTIGGTFCGNAVACAAALKVIEIMERDHLADRSMEIGKKVMKRY
MEWKEKYEIVGDVRGLGGMVGIEFVKNKEKKDPNPEIVSAVIQEAAQNGLMIENSGVYGN
VIRFLAPLVITDKQLEAGLDIFEKAISKCMQK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaggaacaattacctaaaataataactgataaagtccctggaccgaaagcagaa
gaagtaatacgaagaagagaagatgcagtaccctctgcaattaaatgtgtatatcctgtt
gtaataaaaagggcagaaggtgcggtgattgaggatgttgatgaaaattattttcttgac
tggactggtggtgtaggcgtactaaacgttggattttcccatccagaagtggttgaagct
gtgaaagaacagtcagagaagtatttccatggtatgtttaatattgttacacacgaagga
tatgttaagctggcagagaaaatgaactccattgttcctgtaaagggaaataagaaaaaa
acgtttttcgcaaatagtggagcagaggctgatgaaaatgcagtaaaaatagcaaaagct
tttacaaatagacccaatatagttgtattttcaggggcatttcatggacgtacagttatg
accatggcaatgacatcgaaaaaatcttatgcctatggaatgggaccttttccagatggt
gtataccgtgcagaatttccgtatttatatagaagtcctgaaggaatgccagagagtgaa
accattaattattatatagaaagtattaaaaaagtatttgatcaagcttcaccaccggag
tacgtagcagctatagtagtagaaccacttcagggtgaaggcggatttattccagctccc
attgaatgggttaaagcagtaagaactatttgtgataaatatggtatattgcttgttgca
gatgaggtacaatgtgggttctgccgtacaggtaaaatgtttgcttctgaatattggaag
gaagcaggagcagctccagatataatagcaactgcaaaatctattgcagctggtatgcca
ttaagcgcaataacagcaagggaagagattatggaggcagtaagacccggaacaattgga
ggaaccttctgtggaaatgcagtagcatgtgcagcagcattaaaagtgatagaaattatg
gaaagagatcatttggctgaccgttctatggaaataggtaagaaagtaatgaaacgctat
atggaatggaaagaaaaatatgagattgttggagatgtaagaggactcggcggaatggtt
ggaatagaatttgtaaaaaacaaagaaaagaaagatccaaatcctgaaattgtatcagca
gttattcaagaagcagcccaaaatggacttatgattgagaactcgggtgtttatggaaat
gttatccgctttttagcaccacttgtaattacagataagcagcttgaagcaggattagat
atttttgaaaaagcaatttctaagtgtatgcaaaagtaa

DBGET integrated database retrieval system