KEGG   Catenulispora acidiphila: Caci_0167Help
Entry
Caci_0167         CDS       T00967                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cai  Catenulispora acidiphila
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Caci_0167
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Caci_0167
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Caci_0167
Lipid biosynthesis proteins [BR:cai01004]
 Desaturase
  First
   Caci_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(179179..180144)
Genome map
AA seq 321 aa AA seqDB search
MTQTSVPQQQPTAPATVRGTRGGETQSFKERIALSFVIGVPFAALVIAVPVVWGWGMTWT
DLIIAVVMYAISGHGVTVGFHRLFTHSSFKAKKALRVGLAIAGSLAVQGPVIRWVADHRK
HHRYSDHDGDPHSPWRYGETLPALMKGLWHAHIGWLYNAEQTNQQQYAPDLLKDRAIVRV
SRAFPYLVLVSLLLPAAVGGLVTWSWQGILTAFFWGSLVRIALLHHTTWSINSICHAVGE
RPFRSRDRSGNVWWLAVLSMGESWHNLHHSDPTAARHGVLRGQIDSSARIIWLFEKFGWV
RDVRWPSRERVALKLRGEAAP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaacctcggttccgcagcagcagcccaccgcccccgccacggtccgaggaacc
cgcgggggcgagacccagtccttcaaggagcgcatcgccctcagcttcgtcatcggcgtg
cccttcgccgccctggtgatcgccgtccccgtggtctgggggtggggcatgacatggacc
gatctgatcatcgcggtggtgatgtacgccatcagcggccacggcgtgacggtcggcttc
caccgcctgttcacccattcctccttcaaggccaagaaggcactgcgggtgggtctggcg
atcgccggctcgctggcggtccagggcccggtgatccgctgggtcgccgaccaccgcaag
caccaccgctacagcgaccacgacggcgatccgcactcgccgtggcgctacggcgagacg
ctcccggccctgatgaagggcctgtggcacgcgcacatcggctggctgtacaacgccgag
cagaccaaccagcagcagtacgccccggacctgctgaaggaccgggcgatcgtgcgcgtc
tcgcgcgccttcccctacctggtgctggtctccctgctgctgccggcggccgtcggcggg
ctggtgacctggagctggcaggggatactgaccgccttcttctggggctcgctggtccgc
atcgcgctgctgcaccacacgacctggtcgatcaactcgatctgccacgccgtcggcgag
cgcccgttccgctcccgcgaccgctccggcaacgtctggtggctggcggtgctctccatg
ggcgagtcctggcacaacctgcaccactcggacccgaccgcggcccgccacggcgtgctg
cgcgggcagatcgactcctcggcgcggatcatctggctgttcgagaagttcgggtgggtc
cgggatgtgcggtggccttcccgggagcgggtcgccttgaaattgcgcggtgaagccgct
ccataa

DBGET integrated database retrieval system