KEGG   Catenulispora acidiphila: Caci_0680Help
Entry
Caci_0680         CDS       T00967                                 

Definition
hypothetical protein
Orthology
K02004  
putative ABC transport system permease protein
Organism
cai  Catenulispora acidiphila
Module
Putative ABC transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(788176..790605)
Genome map
AA seq 809 aa AA seqDB search
MSALGKVVRSGVGRRRVQSFVMALTTLAAVTSSVLSLGLLTAVSAPFEHAFAHRHGAHLA
VQFNGSKAAPDQIAATAHAAGVTESSGPYPITTALDTTIGSDCTATGGPGMPFAGSSAPA
ATVSTRPSLSGGSGLDQIVLDHGAWPTTANQIVLNNFPVDCLGKSVVFSSLPGKPSFVVV
GFANSLTSTATGWTTEAGFARLTAGGAQADSQMLYRFASAGTDAQIAADRQAVTAAAPAG
AYEGSQSYLTAEQQATGNAKAFVPFLIVFGFLGLFLSVLIIAIVVSGAVVSATRRIGILK
SLGFTPAQVARAYAAQALIPAAVGVIAGTVFGNLLAVPVLNGTSHDLGAAGAGLPLWVSI
VVPLGTLVLVGITALVPALRAGRLPAVQTLVVGRAPRAERGRAAQRLASRLPLPRAMSLG
LAQPFARPARAALVGAAVLFGAVSVTFALGLETGFSRFQQERTAGFNDASVIVVPSHSDS
SGIPHGPGGFYGPNDPRTPHLDPAKVAAALASVPGTEAAFGWGDSGATIIGAPTGDPSEV
DTISGTFSWTGLELISGRWYSGPGEAVVSDRLASAMGTHVGDTVTVVQSGKPLALKVVGI
DFDTHDSGRSVLVDSATFSAAGLTPRTDQFNVELGANVDGPNWAASATAALSPLHASVDH
EPGGNRSDVVLTMSALVATLSVMLLAVAALGVLNTVVQDTRERIHDLGIFKALGMTPRQT
VSMVLTSVAFTGLIAGLIGVPIGTALEKATITPMGNAVGMHLPPSVTHTYSLSLWLPLLA
GGVAIAVLGALLPAGWAARSRTAAALRTE
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccctgggcaaggtggtccgctccggcgtcggccggcgccgcgtccagtccttc
gtcatggccctgaccacgctcgccgccgtgacctcctccgtgctctcgctcggtctgctc
accgcggtctcagcgcccttcgagcacgccttcgcgcaccgccacggcgcgcacctggcc
gtgcagttcaacggcagcaaggcggcgccggaccagatcgccgccaccgcgcacgccgcc
ggcgtcaccgagtcctccggcccgtacccgatcaccaccgcgctggacacgacgatcggc
agcgactgcaccgcgaccggcgggcccggcatgcccttcgccggcagctccgcgccggcg
gccacggtgtcgacgcggccgagcctgtcgggcggctccggactggaccagatcgtgctg
gaccacggcgcctggccgacgaccgcgaaccagatcgtcctgaacaacttcccggtcgac
tgcctcggcaagtcggtggtgttcagctcgctgccgggcaagccgtcgttcgtcgtcgtc
gggttcgcgaactcgctgaccagtaccgccaccggctggaccaccgaggccggcttcgcg
cggctgacggccggcggcgcgcaggcggactcccagatgctctaccggttcgcctccgcc
gggaccgatgcccagatcgccgccgaccggcaggcggtcaccgccgccgcgccggctggc
gcctacgaaggctcgcagtcgtacctgaccgccgaacagcaggcgaccggcaacgccaag
gcgttcgtgccgttcctgatcgtgttcggcttcctcggcctgttcctgtcggtgctgatc
atcgcgatcgtggtcagcggcgcggtggtgtcggcgacccggcggatcgggatcctgaag
tcgctcggcttcaccccggcgcaagtggcccgcgcttacgccgcgcaggctttgatcccg
gcggcggtcggcgtgatcgccggaacggtcttcggcaacctgctggccgtcccggtgctg
aacggcaccagccacgatctcggcgcggccggtgccggcctgccgttgtgggtgagcatc
gtcgtgccgctggggacgctggtcctggtcgggatcaccgcgctcgtgccggcgctgcgg
gccggccggctgccggcggtgcagacgctggtggtcggccgggctccgagggccgagcgc
ggacgtgcggcgcagcgtctggcgtcccgcctgccgctgccccgcgcgatgtcgctggga
ctggcccagcccttcgcccggcccgcgcgggccgcgctggtcggcgccgcggtgctgttc
ggagcggtgagcgtgacgttcgcgctggggttggagaccggcttcagcaggttccagcag
gagcggaccgccgggttcaacgacgcctcggtgatcgtggtgccgagtcactccgacagc
agcgggattccgcatggcccgggcgggttctacggtccgaacgacccgcgcacgccgcat
ctggacccggcgaaggtcgccgccgcgctggcctccgtcccgggcaccgaggccgccttc
ggctggggggacagcggcgcgaccatcatcggcgcgccgaccggcgacccgagcgaggtg
gacaccatctccgggaccttctcctggaccgggctggagctgatctccggccgctggtac
tccgggcccggcgaggcggtggtcagcgaccggctggcgtccgcgatggggacgcacgtc
ggcgacactgtcaccgtcgtgcagtcgggcaaaccgctcgccctgaaggtggtcgggatc
gacttcgacacccacgacagcggacgctccgtgctggtcgacagcgcgacgttcagcgcc
gccggactgacgccgcggaccgaccagttcaacgtggagctgggcgcgaacgtcgacgga
ccgaactgggccgcctccgccacggccgcgctgtcgccgctgcacgcgtcggtcgaccac
gagccgggcggcaaccggtccgacgtggtgctgacgatgagcgcgctggtggcgacgctg
tcggtgatgctgctggcggtcgcggcgctcggggtgctgaacaccgtggtccaggacacc
cgcgaacggatccacgacctggggatcttcaaggcgctgggaatgacgccgcggcagacc
gtgagcatggtgctgacctcggtggcgttcaccgggctgatcgccgggctgatcggggtg
ccgatcgggacggcgctggagaaggcgacgatcaccccgatgggcaacgcggtcggcatg
catctgccgccgagcgtgacccacacctactcgctgagcctgtggcttccgctgctggcc
ggcggggtcgccatcgcggtgctcggggcgctgctgccggccggctgggcggcgcggtcg
cggaccgccgcggcgctgcggaccgagtag

DBGET integrated database retrieval system