KEGG   Catenulispora acidiphila: Caci_0680Help
Entry
Caci_0680         CDS       T00967                                 

Definition
hypothetical protein
Orthology
K02004  
putative ABC transport system permease protein
Organism
cai  Catenulispora acidiphila
Module
Putative ABC transport system
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(788176..790605)
Genome map
AA seq 809 aa AA seqDB search
MSALGKVVRSGVGRRRVQSFVMALTTLAAVTSSVLSLGLLTAVSAPFEHAFAHRHGAHLA
VQFNGSKAAPDQIAATAHAAGVTESSGPYPITTALDTTIGSDCTATGGPGMPFAGSSAPA
ATVSTRPSLSGGSGLDQIVLDHGAWPTTANQIVLNNFPVDCLGKSVVFSSLPGKPSFVVV
GFANSLTSTATGWTTEAGFARLTAGGAQADSQMLYRFASAGTDAQIAADRQAVTAAAPAG
AYEGSQSYLTAEQQATGNAKAFVPFLIVFGFLGLFLSVLIIAIVVSGAVVSATRRIGILK
SLGFTPAQVARAYAAQALIPAAVGVIAGTVFGNLLAVPVLNGTSHDLGAAGAGLPLWVSI
VVPLGTLVLVGITALVPALRAGRLPAVQTLVVGRAPRAERGRAAQRLASRLPLPRAMSLG
LAQPFARPARAALVGAAVLFGAVSVTFALGLETGFSRFQQERTAGFNDASVIVVPSHSDS
SGIPHGPGGFYGPNDPRTPHLDPAKVAAALASVPGTEAAFGWGDSGATIIGAPTGDPSEV
DTISGTFSWTGLELISGRWYSGPGEAVVSDRLASAMGTHVGDTVTVVQSGKPLALKVVGI
DFDTHDSGRSVLVDSATFSAAGLTPRTDQFNVELGANVDGPNWAASATAALSPLHASVDH
EPGGNRSDVVLTMSALVATLSVMLLAVAALGVLNTVVQDTRERIHDLGIFKALGMTPRQT
VSMVLTSVAFTGLIAGLIGVPIGTALEKATITPMGNAVGMHLPPSVTHTYSLSLWLPLLA
GGVAIAVLGALLPAGWAARSRTAAALRTE
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccctgggcaaggtggtccgctccggcgtcggccggcgccgcgtccagtccttc
gtcatggccctgaccacgctcgccgccgtgacctcctccgtgctctcgctcggtctgctc
accgcggtctcagcgcccttcgagcacgccttcgcgcaccgccacggcgcgcacctggcc
gtgcagttcaacggcagcaaggcggcgccggaccagatcgccgccaccgcgcacgccgcc
ggcgtcaccgagtcctccggcccgtacccgatcaccaccgcgctggacacgacgatcggc
agcgactgcaccgcgaccggcgggcccggcatgcccttcgccggcagctccgcgccggcg
gccacggtgtcgacgcggccgagcctgtcgggcggctccggactggaccagatcgtgctg
gaccacggcgcctggccgacgaccgcgaaccagatcgtcctgaacaacttcccggtcgac
tgcctcggcaagtcggtggtgttcagctcgctgccgggcaagccgtcgttcgtcgtcgtc
gggttcgcgaactcgctgaccagtaccgccaccggctggaccaccgaggccggcttcgcg
cggctgacggccggcggcgcgcaggcggactcccagatgctctaccggttcgcctccgcc
gggaccgatgcccagatcgccgccgaccggcaggcggtcaccgccgccgcgccggctggc
gcctacgaaggctcgcagtcgtacctgaccgccgaacagcaggcgaccggcaacgccaag
gcgttcgtgccgttcctgatcgtgttcggcttcctcggcctgttcctgtcggtgctgatc
atcgcgatcgtggtcagcggcgcggtggtgtcggcgacccggcggatcgggatcctgaag
tcgctcggcttcaccccggcgcaagtggcccgcgcttacgccgcgcaggctttgatcccg
gcggcggtcggcgtgatcgccggaacggtcttcggcaacctgctggccgtcccggtgctg
aacggcaccagccacgatctcggcgcggccggtgccggcctgccgttgtgggtgagcatc
gtcgtgccgctggggacgctggtcctggtcgggatcaccgcgctcgtgccggcgctgcgg
gccggccggctgccggcggtgcagacgctggtggtcggccgggctccgagggccgagcgc
ggacgtgcggcgcagcgtctggcgtcccgcctgccgctgccccgcgcgatgtcgctggga
ctggcccagcccttcgcccggcccgcgcgggccgcgctggtcggcgccgcggtgctgttc
ggagcggtgagcgtgacgttcgcgctggggttggagaccggcttcagcaggttccagcag
gagcggaccgccgggttcaacgacgcctcggtgatcgtggtgccgagtcactccgacagc
agcgggattccgcatggcccgggcgggttctacggtccgaacgacccgcgcacgccgcat
ctggacccggcgaaggtcgccgccgcgctggcctccgtcccgggcaccgaggccgccttc
ggctggggggacagcggcgcgaccatcatcggcgcgccgaccggcgacccgagcgaggtg
gacaccatctccgggaccttctcctggaccgggctggagctgatctccggccgctggtac
tccgggcccggcgaggcggtggtcagcgaccggctggcgtccgcgatggggacgcacgtc
ggcgacactgtcaccgtcgtgcagtcgggcaaaccgctcgccctgaaggtggtcgggatc
gacttcgacacccacgacagcggacgctccgtgctggtcgacagcgcgacgttcagcgcc
gccggactgacgccgcggaccgaccagttcaacgtggagctgggcgcgaacgtcgacgga
ccgaactgggccgcctccgccacggccgcgctgtcgccgctgcacgcgtcggtcgaccac
gagccgggcggcaaccggtccgacgtggtgctgacgatgagcgcgctggtggcgacgctg
tcggtgatgctgctggcggtcgcggcgctcggggtgctgaacaccgtggtccaggacacc
cgcgaacggatccacgacctggggatcttcaaggcgctgggaatgacgccgcggcagacc
gtgagcatggtgctgacctcggtggcgttcaccgggctgatcgccgggctgatcggggtg
ccgatcgggacggcgctggagaaggcgacgatcaccccgatgggcaacgcggtcggcatg
catctgccgccgagcgtgacccacacctactcgctgagcctgtggcttccgctgctggcc
ggcggggtcgccatcgcggtgctcggggcgctgctgccggccggctgggcggcgcggtcg
cggaccgccgcggcgctgcggaccgagtag

DBGET integrated database retrieval system