KEGG   Catenulispora acidiphila: Caci_0787Help
Entry
Caci_0787         CDS       T00967                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cai  Catenulispora acidiphila
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Caci_0787 (deoA)
Enzymes [BR:cai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Caci_0787 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
919156..920445
Genome map
AA seq 429 aa AA seqDB search
MDAITVIRAKRDRAELTDEQIDWILAAYTDGRVAEEQMSALAMAILLNGMNRREISRWTQ
AMIDSGERMDFSALTRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRASLSTAEMLAILADAGAVVCAAGDGLAPADKKLYALRDVTGTVEAIPLI
ASSIMSKKIAEGTGALVLDVKCGSGAFMKDFADARELAETMVALGTDHGVRTTALITAMD
TPLGRTAGNALEVRESVEVLSGGGPADIRELTLALAREMLDAAGLAGVDPAAKLDDGSAL
DAWKRMIRAQGGDPDAPLPTAKETHVVAADRDGVLVAMDSFKVGVAAWRLGAGRARKEDA
VQAGAGVEWHAVPGDTVRAGQPLFTLHTDTPETFDTALESLAGACDIAAPGTEFTRSPLV
LDRVAASNR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaccgtcatccgcgccaagcgcgaccgcgcggagctcaccgacgagcag
atcgactggatcctcgccgcctacaccgacggccgggtggccgaggagcagatgtccgcg
ctggcgatggcgatcctgctcaacggcatgaaccggcgcgagatctcacgctggacgcag
gcgatgatcgactccggcgagcggatggacttctccgcgctcacgcgcccgaccgtggac
aagcactccaccggcggcgtcggcgacaagatcacgctgccgctggcgccgctggtggcg
gcgtgcggcgcggcggtcccgcagctgtccggccgcggtctgggccacaccggcggcacg
ctggacaagctggagtcgatcccgggctggcgcgcctcgctgtccaccgccgagatgctc
gcgatcctggccgacgccggcgccgtggtctgcgcggccggcgacggtctggcgccggcg
gacaagaagctctacgcgctgcgcgacgtcaccgggaccgtcgaggcgatcccgctgatc
gcgtcctcgatcatgtccaagaagatcgcggagggcaccggcgcgctggtgctggacgtg
aagtgcggcagcggcgcgttcatgaaggacttcgccgacgcccgcgaactggccgagacc
atggtcgccctcggcaccgaccacggcgtccgcaccaccgcgctgatcaccgcgatggac
accccgctgggccgcaccgcgggcaacgccctggaggtgcgcgagtcggtcgaggtgctc
tccggcggcggtccggccgacatcagggagctgacactcgcgctcgcccgcgagatgctc
gacgccgccggcctggccggcgtggacccggcggccaagctcgacgacggctcggcgctg
gacgcctggaagcgcatgatccgcgcccagggcggcgatcccgacgccccgctgccgacg
gcgaaggagacccacgtggtcgccgccgaccgcgacggcgtcctggtcgccatggactcc
ttcaaggtcggcgtggccgcctggcgcctcggcgcgggccgggcgcgcaaggaggacgcg
gtgcaggccggcgccggcgtggagtggcacgcggtccccggcgacaccgtgcgcgccgga
cagccgctgttcaccctgcacaccgacaccccggagaccttcgacaccgcgctggaaagc
ctggccggcgcctgcgacatcgccgcgccggggacggagttcacccggtcgccgcttgtc
ctggaccgcgtcgccgcctcgaaccggtag

DBGET integrated database retrieval system