KEGG   Catenulispora acidiphila: Caci_0974Help
Entry
Caci_0974         CDS       T00967                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cai  Catenulispora acidiphila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caci_0974
   01230 Biosynthesis of amino acids
    Caci_0974
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caci_0974
   00030 Pentose phosphate pathway
    Caci_0974
   00051 Fructose and mannose metabolism
    Caci_0974
   00052 Galactose metabolism
    Caci_0974
  Energy metabolism
   00680 Methane metabolism
    Caci_0974
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Caci_0974
Enzymes [BR:cai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Caci_0974
Protein phosphatases and associated proteins [BR:cai01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Caci_0974
Messenger RNA biogenesis [BR:cai03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Caci_0974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1112347..1113666)
Genome map
AA seq 439 aa AA seqDB search
MNTADLLTITSDDLAITRLGERTVDTPLSDLLGERQETWHYVTETDRVMLDVVQGIANKR
DVDVAGLPAFNPGGPRRKLFFEPSEVTAAIVTCGGLCPGLNNVIRGLVLHLGRAYGVKRV
LGFRNGFKGLTDGSEPMELTEQSVADIQNRGGTILGTSRGNQDPVVAVDSMVRLGVNILF
VIGGDGTLRGASKLADEARARGERIAVVGIPKTIDNDIPWIDRSFGFHTAFAQAAQSIRA
AHIEASSTENGVGLVKLMGRHSGFIACYSTLASHDVDFTLIPEVPFDVDVLMSRLKKKVE
AQGHAVVVVAEGAGQEHFPASDQTDASGNAKLNDIGALLKKRIIDAFGDEPLSVRYVDPG
YEIRSVPANAFDAVYCTRLAQAATHAGMAGFTSMVVGQWSGRMVHLPIALATASRNVVDP
HGQLWMNVLETTGQPKQML
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggccgatcttctcaccatcacttccgatgatctggccatcacgcgcctgggc
gagcgcactgtggacaccccgctctcggacctgctcggggagcggcaggagacgtggcac
tacgtcaccgagaccgaccgggtcatgctggacgtcgtgcagggcatcgcgaacaagcgc
gacgtggacgtggcgggcctgcccgccttcaaccccggcggtccgcgccgcaagctgttc
ttcgagccctccgaggtcaccgccgccatcgtcacctgcggcggcctgtgccccggcctg
aacaacgtgatccgcggcctggtcctgcacctcgggcgcgcctacggcgtcaagcgcgtc
ctgggcttccgcaacggcttcaagggcctcaccgacggctccgagccgatggagctcacc
gagcagtcggtcgccgacatccagaaccgcggcggcacgatactcggcacctcccgcggc
aaccaggacccggtggtcgccgtggactcgatggtccgcctcggcgtcaacatcctgttc
gtcatcggcggcgacggcaccctgcgcggcgcctcgaagctcgccgacgaggcccgagcc
cgcggcgagcgcatcgcggtggtcggcatccccaagaccatcgacaacgacatcccctgg
atcgaccgctccttcggcttccacaccgccttcgcccaggccgcgcagtccatccgcgcc
gcgcacatagaggcctcctcgaccgagaacggcgtcggcctggtgaagctgatgggccgg
cacagcggcttcatcgcctgctactcgaccctcgccagccacgacgtggacttcaccctg
atccccgaggtccccttcgacgtggacgtcctgatgtcccgcctgaagaagaaggtcgaa
gcccaggggcacgcggtggtcgtcgtcgcagagggtgcgggccaggagcacttcccggca
tcagaccagaccgacgcatccgggaacgccaagctgaacgacataggcgccctgctgaag
aagcggatcatcgacgccttcggcgacgagccactgtcggtacgctacgtcgaccccggc
tacgaaatccgctcggtgccagccaacgccttcgacgcggtctactgcacgcggctggcg
caggcggcgacccacgcgggcatggccggcttcacctcgatggtggtcggccagtggagc
ggacgcatggtccacctgccgatcgccctggccacggcgagccggaacgtggtcgatccg
cacgggcagctgtggatgaacgtgctggagacgacggggcagccgaagcagatgctgtag

DBGET integrated database retrieval system