KEGG   Catenulispora acidiphila: Caci_1015Help
Entry
Caci_1015         CDS       T00967                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cai  Catenulispora acidiphila
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Caci_1015
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Caci_1015
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Caci_1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1155402..1155890
Genome map
AA seq 162 aa AA seqDB search
MSLYDIPINTLDGKPASLKDYEGKTVLLVNVASRCGLTPQYEGLERLHERFADRGFTVVG
VPCNQFGGQEPGTSEEIQEFCSATYGVTFPLTEKIDVNGDERHALYTELTKATDAEGGNG
DIQWNFEKFLIGSDGTVLKRFRPRTEPEAAEVVEAIEAALPA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagcctttacgacatcccgatcaacaccctcgacggcaagccggcctcgctgaaggac
tacgagggcaagaccgtcctgctcgtcaacgtcgcctcgcgctgcggcctcacgccgcag
tacgaaggtctggagcggctgcacgagcggttcgcggaccgcggcttcaccgtcgtcggc
gttccgtgcaaccagttcggcggccaggagccgggtacctccgaggagatccaggagttc
tgctcggcgacctacggcgtgaccttcccgctcaccgagaagatcgacgtcaacggcgac
gagcgccacgccctttacaccgagctcaccaaggcgaccgacgccgagggcggcaacggc
gacatccagtggaactttgaaaagttcttgatcggctccgacggaacggtgctcaagcgc
ttccgtccgcgcaccgagcccgaggccgccgaagtggtcgaggccatcgaggcggcgctc
ccggcttag

DBGET integrated database retrieval system