KEGG   Catenulispora acidiphila: Caci_1200Help
Entry
Caci_1200         CDS       T00967                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cai  Catenulispora acidiphila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caci_1200
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caci_1200
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Caci_1200
Enzymes [BR:cai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Caci_1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1354785..1355840
Genome map
AA seq 351 aa AA seqDB search
MAWRGVIEEYRQWLPVDAGTPVVTLGEGGTPLLPAPRLSALTGCEVFVKVEGMNPTGSFK
DRGMTTAISLAKQAGAEAVVCASTGNTSSSAAAYAVRGGLKPVVLVPAGKIALGKLAQAL
AHGATQLPVEGNFDDCLRLARELAAKYPVALVNSVNPVRLHGQKTAAFEVVDVLGDAPDI
HALPVGNAGNISAYWLGYQEYAKEGQASRTPRMFGFQAAGAAPLVHGAPVPDPDTIATAI
RIGNPASWDLAIAAREDSSGVIEAVTDEEILAAHRVLSAEEGVFVEPASAAGVAGILKLA
RAGRLESGKRIVVTVTGHGLKDPEWAVKAAPPLPDAVPAEVAAVAEALSLS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcttggcgaggcgtcatcgaggagtaccgacagtggctgccggtcgacgccggcacg
cccgtggtcacgctgggcgagggcggcacgccgctgctgcccgcgccgcgcctgtccgcc
ctcaccgggtgcgaggtgttcgtcaaggtcgagggcatgaacccgaccggctcgttcaag
gaccgcggcatgaccaccgcgatctcgctggccaagcaggccggcgccgaggccgtggtg
tgcgcctccaccggcaacaccagctcctcggccgccgcctacgcggtgcgcggcgggctc
aagccggtggtgctggtgccggccggcaagatcgcgctgggcaagctggcccaggcgctg
gcgcacggcgcgacccagctgccggtcgagggcaacttcgacgactgtctccggctggcc
cgcgagctggccgcgaagtacccggtcgcgctggtgaactcggtgaacccggtccggctg
cacggtcagaagaccgccgcgttcgaggtcgtcgacgtgctcggcgacgccccggacatc
cacgccctgccggtcggcaacgccggcaacatctccgcgtactggctcgggtatcaggag
tacgcgaaggagggtcaggcctcgcgcacgccccgcatgttcggcttccaggccgccggc
gccgccccgctcgtgcacggcgcgccggtcccggacccggacaccatcgccaccgccatc
cgcatcggcaaccccgcgtcctgggacctggcgatcgccgcgcgcgaggactcctccggc
gtcatcgaggcggtgaccgacgaggagatcctcgccgcgcaccgtgtgctctcggccgag
gagggcgtgttcgtcgagccggcctccgccgccggcgtcgcgggcatcctcaagctcgcc
cgagccggccgcctcgagtccggcaagcgcatcgtggtcacggtcaccggccacggtctg
aaggaccccgagtgggcggtcaaggccgcgccgccgctgccggacgccgtcccggcggag
gtcgccgcggtcgccgaggctctcagcctcagctaa

DBGET integrated database retrieval system