KEGG   Catenulispora acidiphila: Caci_1323Help
Entry
Caci_1323         CDS       T00967                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cai  Catenulispora acidiphila
Pathway
cai00010  Glycolysis / Gluconeogenesis
cai00071  Fatty acid degradation
cai00350  Tyrosine metabolism
cai00625  Chloroalkane and chloroalkene degradation
cai00626  Naphthalene degradation
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
cai01120  Microbial metabolism in diverse environments
cai01130  Biosynthesis of antibiotics
cai01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caci_1323
  Lipid metabolism
   00071 Fatty acid degradation
    Caci_1323
  Amino acid metabolism
   00350 Tyrosine metabolism
    Caci_1323
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Caci_1323
   00626 Naphthalene degradation
    Caci_1323
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Caci_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C Sacchrp_dh_NADP Methyltransf_25 TrkA_N 2-Hacid_dh_C ThiF
Motif
Other DBs
NCBI-ProteinID: ACU70247
JGI: Caci_1323
UniProt: C7Q7F9
Position
1502119..1503159
Genome map
AA seq 346 aa AA seqDB search
MKALQYPAVGAAPVVLDVPDPEPGPGQVLLKVTAAGVCHSDIAVMSMPAAALRFPLPLTL
GHEGAGTVEALGDGATGFALGESVAVYGPWGCGMCHMCAQGKENYCLRAAELQIFPPGLG
APGAIAQYLLVDASRHLVPLGDLDPVRSVPLTDAGLTPYHAIKTSLPKLVGGSTAVVIGA
GGLGHVAIQLLRALSPARVVALDVAPEKLELAKEVGAHEALMSDEKAALAVKELTGGRGA
EAVFDFVGAPPTVALASACAGVESDVTIVGIGGGSAQVGFGVTPYDAAFRAPYWGTRAEL
VEVLDLARDGAVSVHVETYSIEEAPRAYERLHAGQVRGRAVILPNG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccctccagtaccccgcggtcggcgccgccccggtggtcctcgacgttccggac
cccgaacccggcccaggccaggtgctgctgaaggtcaccgcggccggcgtctgccactcc
gacatcgcggtgatgagcatgcccgccgccgcgctgcgcttcccgctgccgctgaccctc
gggcacgagggcgccgggacggtcgaggcgctcggcgacggcgcgaccggcttcgccctc
ggcgaaagcgtggccgtctacgggccctggggctgcggcatgtgccacatgtgcgcgcag
ggcaaggagaactactgcctgcgcgccgcggagttgcagatcttcccgcccggactcggc
gcgcccggcgcgatcgcccagtacctgctcgtcgacgcctcgcggcatctcgtcccgctc
ggcgacctggacccggtccgcagcgtcccgctgaccgacgccggcctgaccccgtaccac
gccatcaagacctcgctgccgaagctggtcggcggcagcaccgcggtggtgatcggcgcc
ggcggcctgggccacgtcgcgatccagctgctgcgcgccctgagcccggcgcgcgtcgtc
gcgctggacgtggcgccggagaagctggaactcgccaaggaggtcggggcgcacgaagcc
ctgatgtccgacgagaaggccgcgctggcggtgaaggagctgaccggcggacgcggcgcc
gaggcggtcttcgacttcgtcggcgcgcccccgaccgtcgccctggcctcggcctgcgcc
ggcgtggagtccgacgtcacgatcgtcggcatcggcggcggcagcgcgcaggtcggcttc
ggcgtgacgccctacgacgcggccttccgcgcgccgtactggggcacccgcgccgaactc
gtcgaagtgctcgacctggcacgcgacggagcggtgtcggtgcacgtcgagacgtacagc
atcgaggaggcgccgagggcgtacgaacggctgcacgccggccaagtccgggggcgggcc
gtcatcctccccaacggctga

DBGET integrated database retrieval system