KEGG   Catenulispora acidiphila: Caci_1657Help
Entry
Caci_1657         CDS       T00967                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cai  Catenulispora acidiphila
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cai00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cai00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1881102..1882700
Genome map
AA seq 532 aa AA seqDB search
MTSTPRPHHIPQHSVRACADFVGASVAGGAAATTQALDTTVTGLSHDSQGIRPGDLYLAW
PGAARHGAEFAPGAVASGAVAVVTDAAGAAMLDGLAVPVLVAEDVRGLAGRLSAFVYGEP
ATRLAMYGVTGTNGKTTTSYLIDGGLRRAGLKTGVIGTVQILIGDEVVPSVRTTPEAPDL
QAILATAVEKDVDAIAMEVSSHALAYGRTAGIRFKAAAFLNLTQDHLDFHADFEDYFEAK
AKLFTPGYTERAVVDVDDEHGRRVVERCRANGVQVHTFSIKGAAADWTAEDIVLDADAST
FTVAGPDGRRHKASAGLPGDFNVANALAAIVLLAVTGIDLETAIAGVADVHGVPGRMERI
QVPGQQFLAVVDYAHTPDAVLTALSALRPVAERGRGRLRVVVGCGGDRDKTKRPLMGAAA
VRLADEAVFTDDNPRTESSADILAAVTAGADAELAGAEKNYRVVADRAEAIRRAVAASGP
GDVLIVAGKGHEQGQEIAGVKKPFDDRVVLRAALEASAGAAAATAEKGPGEQ
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacctccacaccgcgcccgcaccacattccgcagcacagcgtccgcgcctgcgcggac
ttcgtcggcgcttccgtcgccggcggcgcggccgcgaccacccaggccctggacacgacg
gtcaccgggctctcgcacgattcgcagggcatccgccccggcgacctgtacctcgcctgg
ccgggcgcggcgcggcacggcgccgagttcgcccccggcgcggtggcctccggagcggtc
gcggtcgtgaccgacgccgcgggcgccgcgatgctcgacggtctggcggtaccggtcctg
gtcgccgaggacgtgcgcggtctggccggccggctgtcggcgttcgtctacggcgaaccc
gcgacccgcctggcgatgtacggcgtcaccggtaccaacggcaagaccaccaccagctac
ctgatcgacggcggtctgcgccgcgccggactgaagaccggcgtgatcgggaccgtgcag
atcctcatcggcgacgaggtggtgccctccgtgcgcaccaccccggaggcgccggacctg
caggcgatcctggcgaccgccgtggagaaggacgtcgacgcgatcgcgatggaggtctcc
agccacgcgctggcctacggccgcaccgccgggatccggttcaaggcggccgcgtttctg
aacctgacgcaggaccacctggacttccacgccgacttcgaggactacttcgaggccaag
gcgaagctgttcacgccggggtacaccgagcgcgcggtcgtcgacgtcgacgacgagcac
ggtcggcgcgtcgtcgagcgctgccgcgccaacggtgtgcaggtgcacaccttctccatc
aagggcgcggccgcggactggaccgccgaggacatcgtgctggacgccgacgcctcgacg
ttcaccgtcgccggcccggacggccgccggcacaaggcctccgccggattgcccggcgac
ttcaacgtcgccaacgcgctggccgcgatcgtgctgctggcggtcaccgggatcgacctg
gagaccgccatcgccggggtcgccgacgtgcacggggtcccgggccgcatggagcggatc
caggttcccggccagcagttcctcgcggtcgtcgactacgcccacacccccgacgcggtg
ctgaccgcgctgagcgcgctgcggccggtggccgagcgcggccgcggccggctgcgcgtg
gtggtgggctgcggcggggaccgcgacaagaccaaacggccgttgatgggcgccgccgcg
gtgcggctcgccgacgaggccgtgttcaccgatgacaacccgcgtacggagagttcagcg
gacattctcgcggccgtcaccgccggcgccgacgccgaactggccggtgccgagaagaat
taccgcgtggtcgccgaccgggccgaggcgatccgccgcgcggtcgccgccagcggcccc
ggcgacgtgctgatcgtcgccggcaagggacatgagcaggggcaggagatcgcaggagtg
aagaagccgttcgacgaccgggtggtgctgcgcgccgctttggaggcgtcggctggtgcg
gccgcggccacggcggagaaggggcccggcgagcagtga

DBGET integrated database retrieval system