KEGG   Catenulispora acidiphila: Caci_1829Help
Entry
Caci_1829         CDS       T00967                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cai  Catenulispora acidiphila
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caci_1829
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caci_1829
  Amino acid metabolism
   00310 Lysine degradation
    Caci_1829
Enzymes [BR:cai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Caci_1829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2074531..2076534)
Genome map
AA seq 667 aa AA seqDB search
MSVSVVLPAMGESVTEATITRWLKKEGDRVEVDEPLLEVSTDKVDTEIPSPAAGFLVSIK
VGEDETVEVGAELAVIGDTADAAGGGNGGGAPQAAPAQAEAPAPQQQAAPAPQAAPAPQP
QAQQQPAPQAQAPAQEQAQAPSGGGSASGTPITLPAMGESVTEATVTRWLKAVGDTVEVD
EPLLEVSTDKVDTEVPSPVAGVLLEISVAEDETIDIGAQLAVIGAPGSSAPAQQQAPAAP
AQPQQQAAPAPQAAPAPQAQPQQQAAPAPQPQAQQPASLPSTPPVAPSAPAPQAPAPAVA
NAPSYTATAPAPNGQAQQSAPAAGGEFRPGTPAVVAQAQTAARVDAPGAGSEPAAAYVTP
LVRKLAAEHSVDLASVTGTGVGGRIRKQDVIDAAKAAQASAAAAAPAPAAASTGSAPAAK
APVTPSPLRGRTEKLTRMRALIAKRMLESLQTSAQLTTVVEVDVTNVARLRTRAKNEFEA
REGVKLSFMPFFALAAIEALKQHPNLNAVIDTEAGTVTYHDYENLAIAVDSEKGLMTPVI
KNAGDLNLAGLARGIADLAERTRTNKVLPDELAGGTFTLTNTGSRGALFDTPILNQPQVG
ILGTGAVVKRPAVINDPDLGEVIAVRSMVYLALTYDHRLVDGADAARFLVTIKERLEEGK
FDSDLGL
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtctcagtagttctgcccgcgatgggtgagtcggtcaccgaggccaccatcacc
cgctggctgaagaaggaaggcgaccgggtcgaggtcgacgagccgctgctcgaggtctcc
accgacaaggtcgacaccgagatcccgtccccggcggccgggttcctggtgtcgatcaag
gtcggcgaggacgagacggtcgaggtcggcgcggagctggcggtcatcggcgacaccgcg
gacgcggccggcggcgggaacggcggcggcgcgccgcaggccgccccggcgcaggccgag
gctccggcgccgcagcagcaggcggcgcccgcgccccaggccgccccggctccgcagccg
caggctcagcagcagccggctccgcaggctcaggctccggcgcaggagcaggcgcaggcg
ccgtccggcggcggctcggcctccggcaccccgatcacgctgccggcgatgggcgagtcg
gtcaccgaggcgaccgtcacccgctggctgaaggccgtcggcgacaccgtcgaggtcgac
gagccgctgctcgaggtctccacggacaaggtcgacaccgaggtcccctcgccggtcgcc
ggcgtgctgctggagatcagcgtcgccgaggacgagacgatcgacatcggcgcgcagctc
gcggtgatcggcgccccgggctcgtcggctccggcgcagcagcaggctccggccgctccg
gcgcagccgcagcagcaggcggcgcccgcgccccaggccgccccggccccgcaggcccag
ccgcagcagcaggccgccccggctccgcagccgcaggcccagcagccggcgtcgctgccc
agcaccccgccggtcgcgccgtccgccccggctccgcaggctccggccccggccgtggcc
aacgcgccgtcctacaccgcgaccgccccggcgccgaacggccaggctcagcagtccgcc
ccggctgccggcggcgagttccgtccgggcaccccggcggtcgtcgcgcaggcccagacc
gccgcccgcgtcgacgcccccggcgccggcagcgagccggccgcggcctacgtcaccccg
ctggtccgcaagctggccgccgagcacagcgtggacctggcgagcgtcaccggcaccggg
gtcggcggccggatccgcaagcaggacgtgatcgacgcggccaaggcggcccaggccagc
gcggccgccgccgctccggctccggccgcggcgtccaccggctccgcgccggccgccaag
gcgccggtcaccccgagcccgctgcgcggccgcaccgagaagctgacccggatgcgcgcg
ctgatcgccaagcgcatgctcgagtcgctgcagacctcggcgcagctgaccacggtggtc
gaggtggacgtcaccaacgtcgcccgcctgcggacccgcgccaagaacgagttcgaggcg
cgcgagggcgtgaagctctcgttcatgccgttcttcgccctggccgcgatcgaggcgctc
aagcagcacccgaacctgaacgcggtcatcgacaccgaggccggcacggtcacctaccac
gactacgagaacctggcgatcgcggtcgacagcgagaagggcctgatgaccccggtcatc
aagaacgccggcgacctgaacctggcgggcctggcccgcgggatcgcggacctggccgag
cggacccgcaccaacaaggtcctgcccgacgagctggccggcggcacgttcacgctgacc
aacaccggcagccgcggcgcgctgttcgacaccccgatcctgaaccaaccgcaggtcggc
atcctcgggaccggcgcggtcgtgaagcgtccggcggtcatcaacgaccccgacctcggc
gaggtcatcgcggtccgctcgatggtctacctggccctgacgtacgaccaccgcctggtg
gacggcgcggacgccgcccgcttcctggtcacgatcaaggagcggctggaagagggcaag
ttcgactcggacctcggtctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system