KEGG   Catenulispora acidiphila: Caci_2199Help
Entry
Caci_2199         CDS       T00967                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cai  Catenulispora acidiphila
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Caci_2199
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Caci_2199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2493197..2494900)
Genome map
AA seq 567 aa AA seqDB search
MDYDVLVIGSGFGGSVTALRLTEKGYKVGVLEAGRRFADGDFPKTSWRLRSFLWAPKLGC
KGIQRIHRLKDVVVLAGAGVGGGSLVYANTLYEPLDPFYDDPHWQDVADWRTELAPFYDQ
AKRMLGVVQNPTMTPADVQMKAVAEEMGVGDTFHLTPVGVFFGDPDATAAAPVSDPFFGG
AGPDRNPCLQCGACMTGCRHNAKNTLVKNYLYLAEKLGAEVHPLTTVESVTPLLDGGGYQ
VRVSSTGAWFAKGRRTLTAEHVVFSAGALGTQRLLHKLAGDGSLPSLSPRLGELTRTNSE
SLLGAMAKKPRQYDFTEGVAITSSFHPDDHTHIEPVRYGRGSGAMGLLKTGLTDGEGRTP
RWIKLLGIGVKHPSWVPRMLPSRKFAERSIILLVMQALDNSLTVSRKRGLFGKNKLTTRQ
GHGQPNPTWIPAGNEAVTRTAARINGIPGGTVGDLFNIPMTAHIIGGCVIGRDRDHGVVD
PYHRVFGHPGLYVADGSTVSANLGVNPSLTITAMAERAAAFWPNKGEADTRPALGEPYKR
IPYVRPAKPAVPEAAPGALRLPIVEIR
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
gtggactacgacgtgctggtcatcggctcgggcttcggcggttcggtgaccgcgctgcgg
ctcaccgagaagggctacaaggtcggcgtgctggaagccgggcgccgcttcgccgacggc
gacttccctaagacctcctggcgcctgcgctcgttcctgtgggcaccgaagctgggctgc
aagggcatccagcgcatccaccggctcaaggacgtcgtcgtgctcgccggagccggggtc
ggcggcgggtcgctggtgtacgcgaacacgctgtacgaaccgctcgacccgttctacgac
gacccgcactggcaagacgtcgccgactggcgcaccgaactcgccccgttctacgaccaa
gccaagcggatgctcggcgtggtgcagaacccgacgatgacgccggcggacgtccagatg
aaggcggtcgccgaggagatgggtgtcggggacaccttccacctcacgccggtcggggtc
ttcttcggcgatccggatgccacggcggccgcccctgtctccgaccccttcttcggcggc
gcgggtccggaccggaacccgtgcctgcagtgcggcgcatgcatgaccggatgccggcac
aacgccaagaacaccctcgtcaagaactacctgtatctcgccgagaagctcggcgccgag
gtgcatccgctgacgaccgtcgagagcgtgacaccgctgctcgacggcggcggctaccag
gtgcgcgtgtcctcgaccggagcgtggttcgccaagggccggcgcaccctgaccgccgag
cacgtcgtcttcagcgccggcgccctgggaacccagcgcctcctgcacaaactggccggc
gacggatcgctgccgtcgctgtccccgcgcctgggcgaactgacccgcaccaactccgaa
tcgctcctcggcgcgatggccaagaagccgcggcagtacgacttcacggaaggggtggcc
atcacctcctccttccaccccgacgaccacacgcacatcgagccggtgcgctacggccgc
ggcagcggcgcgatggggttgctgaagaccggactgaccgacggcgagggccgcaccccg
cgctggatcaagctgctcggcatcggcgtgaagcacccctcctgggtcccgcgcatgctg
cccagccgcaagttcgcggagcgctcgatcatcctgctggtgatgcaggccctggacaac
tcgctgaccgtctcccgcaaacgcggcttgttcggcaagaacaaactcaccacccgccaa
ggccacggtcagcccaacccgacctggatcccggccggcaacgaagccgtgacccgcacc
gcggctcgcatcaacggcatccccggcggcaccgtcggcgacctgttcaacatccccatg
accgcgcacatcatcggtggctgcgtcatcggccgcgaccgcgaccacggcgtcgtcgac
ccttaccaccgcgtgttcggccaccccggcctgtacgtcgcggacggctcgacggtctcg
gcgaatctcggcgtgaacccctcgctgacgatcacggcgatggccgagcgtgccgccgcg
ttctggccgaacaagggcgaggcggacacgcgccccgcgctaggggaaccgtacaagcgg
attccctatgtgcggccggcaaagcccgcggtcccggaggcggctccgggtgcgttgagg
ctgccgatcgtggagatccgatag

DBGET integrated database retrieval system