KEGG   Catenulispora acidiphila: Caci_2401Help
Entry
Caci_2401         CDS       T00967                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cai  Catenulispora acidiphila
Pathway
cai00240  Pyrimidine metabolism
cai00250  Alanine, aspartate and glutamate metabolism
cai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Caci_2401
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Caci_2401
Enzymes [BR:cai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Caci_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: ACU71319
JGI: Caci_2401
UniProt: C7PVS7
Position
2718055..2719041
Genome map
AA seq 328 aa AA seqDB search
MKRHLLSTADLSRDDAVLILDTAEEIARLAARPIKKLPTLRGRTVVNLFFEDSTRTRTSF
EVAAKRLSADVINFSAKGSSVSKGESLKDTALTLEAMGADAVVVRHSASGAAYRLANAGW
SSSHVVNAGDGTHEHPTQALLDAFTMRRHLGGFDGRRVTVVGDVLHSRVARSNVHLLATL
GARVTLVAPPTLLPVGVESWPCDVSYDLDAAVPGSDAIMMLRVQRERMNGGFFPTQREYS
RRYGLDAQRMANLPDKAIVMHPGPMVRGMEISAAVADSDRSVIVEQVANGVSVRMAVLYL
LLSGSESAIGSDEGHHQHQNTEPKGAAA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgccatctgttgtccaccgccgacctctcccgcgacgacgcggtgctgatcctg
gacaccgccgaggagatcgcccggctggcggcccgcccgatcaagaagctgccgacgctg
cgcgggcgcaccgtggtgaacctcttcttcgaggactccacccggacccggacctccttc
gaggtcgcggccaaacggctcagcgccgacgtgatcaacttctcggccaagggctccagc
gtctccaagggcgagtcgctgaaggacaccgcgctcaccctggaggccatgggcgccgac
gccgtcgtggtgcggcacagcgcctccggcgcggcctaccggctggccaacgccggctgg
agctccagccatgtggtcaacgccggcgacggcacccacgagcaccccacgcaggccctg
ctggacgccttcaccatgcgccgccacctcggcggcttcgacggccgccgggtcaccgtg
gtcggcgacgtcctgcactcccgcgtcgcgcgctccaacgtgcacctgctggccaccctc
ggcgcccgggtcaccctggtcgccccgcccacgctgctcccggtcggcgtcgagagctgg
ccctgcgacgtctcctacgacctggacgcggccgtccccggcagcgacgcgatcatgatg
ctgcgggtccagcgcgagcggatgaacggcggcttcttccccacgcagcgcgagtacagc
cgccgctacggcctggacgcgcagcgcatggccaacctgccggacaaggcgatcgtcatg
caccccgggccgatggtccgcggcatggagatctccgccgcggtcgccgactccgaccgc
tcggtgatcgtcgagcaggtcgccaacggggtcagcgtccggatggccgtgctctacctg
ctgctcagcgggagcgagtcggcgatcggcagcgacgagggccaccaccagcaccagaac
accgaaccgaagggcgccgccgcgtga

DBGET integrated database retrieval system