KEGG   Catenulispora acidiphila: Caci_3167Help
Entry
Caci_3167         CDS       T00967                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cai  Catenulispora acidiphila
Pathway
cai00520  Amino sugar and nucleotide sugar metabolism
cai01100  Metabolic pathways
cai01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Caci_3167
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Caci_3167
Enzymes [BR:cai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Caci_3167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Apt1 EFG_IV
Motif
Other DBs
NCBI-ProteinID: ACU72075
JGI: Caci_3167
UniProt: C7Q669
Position
complement(3496455..3497771)
Genome map
AA seq 438 aa AA seqDB search
MADAGMRSGRGKKTGGVAAVTLVAAVGLLSGACSSGASKPAAQGSSSSSSTTTSSTPTTT
SSSSTPTTTSSSSSSSSSAPSSSSSSTTPKPPTTPSSSPAAPGNLTLQQEAGQRVIYSYQ
GLTPPQHLLTLIRQGDVGGVIFFGGNISSQSQIAGVITELRQAQAASPVHLPLLLMTDQE
GGIVKRLPGPPYDSAKQVGQSSNPPGAATAQGTAAGQNMAGVGMNLNLAPVLDVYRTPGN
FLDAAQRSFSQNPNTVSQLGSNFIVAQQNTGVAATAKHFPGLGSAPNGANTDEHPVTLTV
SLSNLRSIDELPYAAAVQNGLKLVMMSWAIYPALDANRPAGMSSTIVQQELRDRVGFKGV
TITDALEAGALQAYGTAGNRALSAAEAGMDLLLCSSGDPAQGDAAAAALVAAVNNGKLSR
SGFDAAVGRVDALRGGLK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgctgggatgcggagcggacggggcaagaagaccggcggcgtggcggcggtg
acgctggtcgcggcggtggggttgctgagcggggcgtgctccagcggcgcgtcgaagccg
gcggcgcaggggagttcgagctcgtcgtccacgacgacttcgtcgacaccgacgacgacg
tcttcgtcctcgacaccgacgactacttcgtcgtcgagctcctcgtcgtcctcggcgccg
tcttcgtcgtcgagctcgacgaccccgaagccgccgacgactccgtccagctcgcccgcg
gcgcccgggaacctgacgctgcagcaggaggccgggcagcgggtcatctactcctaccag
ggcctgaccccgccgcagcatctgctgaccctgatccggcagggcgacgtcggcggcgtc
atcttcttcggcggcaacatctccagccagtcgcagatcgccggcgtcatcaccgagctg
cgccaggcgcaggcggccagcccggtccacctgccgctgctgctgatgaccgaccaggag
ggcggcatcgtcaagcgcctgcccggaccgccgtacgactcggcgaagcaggtcggccag
agctcgaacccccccggcgcggcaaccgcccaaggcaccgcagccggacagaacatggcg
ggcgtcggcatgaacctgaacctcgcgccggtcctggacgtctaccgcaccccaggcaac
ttcctcgacgccgcccagcgctccttcagccagaacccgaacacagtctcgcagctgggc
tcgaacttcatcgtggcccagcagaacaccggcgtagccgccaccgccaagcacttcccc
ggcctcggctccgcacccaacggcgccaacaccgacgagcacccggtgaccctcaccgtg
tccctgagcaacctgcgcagcatcgacgaactgccctacgccgcagcagtgcagaacggc
ctgaaactggtgatgatgtcctgggcgatctacccggccctagacgccaaccgcccggca
ggcatgtcctccacaatcgtccagcaggaactacgcgaccgcgtcggcttcaagggcgtg
accatcaccgacgcgctggaagccggcgcgctgcaggcgtacggcaccgcgggcaaccgc
gccctgtcggcagcggaggcaggcatggacctcctgctgtgctcctccggcgacccggcg
cagggcgacgccgcggcagcagcactcgtggccgccgtgaacaacgggaagctgagccgg
agcgggttcgacgcggcggtggggcgggtcgacgcgctgcggggtgggttgaagtag

DBGET integrated database retrieval system