KEGG   Catenulispora acidiphila: Caci_3232Help
Entry
Caci_3232         CDS       T00967                                 

Definition
group 1 glycosyl transferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
cai  Catenulispora acidiphila
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Caci_3232
Enzymes [BR:cai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Caci_3232
Glycosyltransferases [BR:cai01003]
 Polysaccharide
  Storage polysaccharide
   Caci_3232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3566586..3567980
Genome map
AA seq 464 aa AA seqDB search
MSGPLRELTMTKEENDAMALVRATVPAPPRPASRSLRILMLSWEYPPVVVGGLGRHVHAL
ARNLVRAGHQVTVATRHAPGAPLDEIVEGVRVVRAPDDPPAIPLDTPHLLAWTMAFNHTL
TRAALHAADTGEYDLVHAHDWLVTHAAITMRDHLRVPLVATVHATEAGRHQGWLPGDLNR
AIHSVECWLGAEAERVLVCSKYMGREVGALLGVPAAKTEVIPNGVDIPRWSPNPAEVAAA
RSRYAGNGPLIGFAGRLVYEKGVQHLLHAVPELRRRHPGLRVVIAGDGPQRGELEATAGR
LDLHHEVSFTGFVPARGLSSTMASTDAMVVPSIYEPFGLVALEAAAAGAPLAVSETGGLA
EIVEPGVTGLRFAVRDAGALTESVSSLISDREAARTMADAARTMVRERYGWDDVAVATAE
VYAGVVGGARIKRPANLWRSPVVVEREPLRIPEGNLLESAGLLP
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaccgctgcgcgagctgacgatgaccaaagaggagaacgacgcgatggcgctg
gtccgtgcgacggtcccggctccgccgcggcccgcctcccggagcctgcggatcctgatg
ctctcctgggagtacccgccggtcgtggtcggcggtctgggccggcacgtccacgccctg
gcccggaacctggtgcgcgccggccaccaagtcacggtggccacccggcacgcgcccggg
gcgccgctggacgagatcgtcgagggcgtgcgggtcgtgcgcgcccccgacgacccgccg
gccatccccctggacaccccgcacctgctggcctggaccatggcgttcaaccacaccctg
acccgcgccgccctgcacgccgccgacaccggcgagtacgacctggtccacgcgcacgac
tggctggtcacgcacgccgcgatcaccatgcgcgaccacctgcgcgtcccgctggtggcg
accgtgcacgccaccgaggccggccgccaccagggctggctgcccggcgacctgaaccgg
gcgatccattcggtcgagtgctggctcggggcggaggccgagcgggtgctggtgtgctcc
aagtacatgggacgcgaggtcggcgccctgctcggggtcccggcggccaagaccgaggtc
atccccaacggggtcgacatcccgcgctggtcgccgaacccggccgaggtcgctgcggcg
cgctcgcgctacgccgggaacggaccgctgatcggcttcgccggacggctggtctatgaa
aagggtgtgcaacaccttctgcacgccgtccccgaactgcgccgccgccaccccggactg
cgcgtggtgatagccggcgacggaccgcagcgcggcgagctggaagccaccgccggacgc
ctggacctgcaccatgaggtcagcttcaccggcttcgtcccggcgcgcgggctgtcctcg
accatggcctccaccgacgcgatggtcgtgccgagcatctacgagcccttcggcctggtc
gccctggaggcggcggcggccggggcgccgctggcggtgtccgagaccggcgggctggcc
gagatcgtcgaacccggcgtcaccggcctgcggttcgccgtccgggacgccggcgcgctg
accgagtccgtcagctccctgatcagcgaccgcgaggcggcgcgcaccatggccgacgcg
gcgcgcacgatggtccgcgagcgatacggctgggacgacgtcgccgtggccaccgccgag
gtgtacgcgggcgtggtcggcggagcccggatcaagcggcccgcgaacctgtggcgcagc
ccggtcgtcgtcgagcgcgaaccgctgcgcatcccggaggggaacctgctggagtcggcg
gggttgctgccgtga

DBGET integrated database retrieval system