KEGG   Catenulispora acidiphila: Caci_3602Help
Entry
Caci_3602         CDS       T00967                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cai  Catenulispora acidiphila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cai00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4021849..4023153)
Genome map
AA seq 434 aa AA seqDB search
MLSRTARLLLAAGLSASAIALGPVATAATATTAHAPSAGHTLPADTRFAVTPDNEAQRQA
LTDLQHHDLAGAAAMAKLASWPEATWFTSGTPAQVRDQVRATVRTAAAERAVPVLVAYDI
PLRDCSQYSAGGAASDAAYQQWISAFAQGVGSSRAVVIVEPDALANLPSDCNATTDPTGT
LTAGRIADIKYAVSALEAQPQTVVYLDAGNSQWHSVGDMAQRLIQAGVAQSQGFFLNVSN
YQPTDQTDQYGTWISKCLWFATDGPAWAAGHTDYCASQYYSSAAPNDGAPGDAVSPTDAS
TWHWTDAWFDQNVGTPPPAQLTHFVVDTSRNGKGAWTPAPGKYTGDPQTWCNPPGRGIGA
TPTAATGVPLVDADLFIKTIGESDGSCTRSTAGPGDPEYGGTVDPAAGAWWPAQALGLVQ
DAVPTLTFNPRLLP
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccagaaccgcgagactcctgctcgccgcaggtctttccgcatcggccatcgcc
ttgggtccggtcgccacggcggccaccgcgaccacggcgcacgccccgagcgccgggcac
acgctgccggccgacacgcgcttcgccgtcacgcccgacaacgaggcccagcgccaagca
ctgaccgatctgcagcaccacgacctcgccggcgccgcggccatggcgaagctggccagc
tggcccgaggcgacctggttcaccagcggcacgccggctcaggtgcgcgaccaggtccgc
gcgaccgtgcggaccgccgcggccgagcgtgccgttccggtgctggtcgcctacgacatc
ccgctgcgggactgcagtcagtactccgccggcggcgcggcgtccgatgccgcctaccag
cagtggatatcagcgttcgcacaaggggtcggctcgagccgggccgtggtgatcgtcgag
ccggacgcgctggcgaacctgccctcggattgcaatgccaccaccgacccgaccgggacg
ctgaccgccgggcgcatcgccgacatcaagtacgcggtgtccgccctcgaagcccagccg
cagacggtcgtctacctcgacgccggaaacagccagtggcactctgtcggcgatatggcg
cagcgcctgatccaggcaggcgtcgctcagtcccagggcttcttcctcaacgtgtccaac
taccagccgaccgaccagaccgaccagtacggcacctggatctccaagtgcctgtggttc
gccaccgacggtccggcatgggcagccggacacaccgactactgcgccagccagtactac
tcctcggcggcgccgaacgacggagcgcccggcgacgcggtgtccccgaccgatgcgagc
acctggcactggacggacgcctggttcgaccagaacgtcggcactcccccgcccgcgcag
ctgacccacttcgtcgtggacaccagccgcaacggtaagggcgcatggaccccggcgccc
ggcaagtacaccggcgacccccagacctggtgcaaccctccgggtcgcggcatcggcgcc
acgccgaccgccgccaccggcgtcccgctcgtcgacgccgacctgttcatcaagacgatc
ggcgagtccgacggcagctgcacgcgcagcaccgcgggtcccggcgaccccgaatacggc
ggcacggtggacccggcggccggcgcgtggtggccggcccaggcactcggcctcgtccag
gacgccgtcccgacgctgaccttcaatccgcgtctgcttccctga

DBGET integrated database retrieval system