KEGG   Catenulispora acidiphila: Caci_3675Help
Entry
Caci_3675         CDS       T00967                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cai  Catenulispora acidiphila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caci_3675
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caci_3675
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Caci_3675
Enzymes [BR:cai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Caci_3675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
4115230..4116444
Genome map
AA seq 404 aa AA seqDB search
MLHPGTKEPITESDLAPLFPAELIAQEFTKDRDVDIPGAVLDVYKQWRPAPLVRARRLEQ
ALDTPARIYFKYEGVSPAGSHKPNTAVPQAYYNKLAGVAKLTTETGAGQWGSSLSLACSY
FGLECEVFMVKISYQQKPYRRGLMQTYGATVHASPSELTQAGRDALAADPDNPGSLGLAI
SEAVEAAVVGGDDVKYALGSVLNHVLMHQTIIGQEARLQLELAEDYPDIVIGAAGGGSNF
GGLALPFLREQLEGGRSVRAIAVEPSSCPSLTEGKYDYDFGDTAGLTPLAKMHTLGHDFR
PPAIHAGGLRYHGMAPIISALKEAELLEARAVPQTACFEAGVTFARNEGIVPAPESTHAV
RVAIDEALRAKEEGVSRSILFSLSGHGHFDMQAYADYFAGDLTD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacccgggcaccaaggagccgatcactgagtccgacctggctccgctgttcccg
gcggagctgatagcccaggagttcaccaaggaccgcgacgtcgacatccccggcgccgtg
ctggacgtctacaagcagtggcgccccgcgccgctggtccgggcgcggcgtctggagcag
gctctggacaccccggcgcggatctacttcaagtacgagggcgtgagcccggccggcagc
cacaagccgaacaccgccgtgccgcaggcgtactacaacaagctggccggcgtcgccaag
ctcaccaccgagaccggcgccgggcagtggggcagctcgctgtccctggcctgctcctac
ttcgggctggagtgcgaggtcttcatggtgaagatcagctaccagcagaagccctaccgc
cggggtctgatgcagacctacggcgccaccgtgcacgccagccccagcgagctcacccag
gccggccgcgacgcgctggccgccgacccggacaaccccggcagcctgggcctggccatc
tccgaggcggtcgaggcggccgtggtcggcggcgacgacgtcaagtacgcgctgggctcg
gtgctcaaccacgtgctgatgcaccagacgatcatcggccaggaggcgcggctgcagctg
gagctggccgaggactacccggacatcgtgatcggcgcggccggcggcggctccaacttc
ggcggcctggcgctgccgttcctgcgcgagcagctggagggcggccggtcggtgcgggcc
atcgcggtcgagccctcctcctgcccgagcctgaccgagggcaagtacgactacgacttc
ggcgacaccgccgggctcacgccgctggccaagatgcacaccctcgggcacgacttccgc
ccgccggccatccacgccggcggtctgcgctaccacggcatggcgccgatcatcagcgcc
ctgaaggaggccgagctgctggaggcgcgcgccgtcccgcagaccgcgtgcttcgaggcc
ggcgtgaccttcgcccgcaacgagggcatcgtgccggcgccggagtccacgcacgcggtg
cgggtggcgatcgacgaggcgctgcgggccaaggaggagggcgtgagccggtcgatcctg
ttctcgctgtccgggcacgggcacttcgacatgcaggcctacgccgactacttcgccggc
gatctgacggactga

DBGET integrated database retrieval system