KEGG   Catenulispora acidiphila: Caci_3675Help
Entry
Caci_3675         CDS       T00967                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cai  Catenulispora acidiphila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caci_3675
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caci_3675
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Caci_3675
Enzymes [BR:cai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Caci_3675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4115230..4116444
Genome map
AA seq 404 aa AA seqDB search
MLHPGTKEPITESDLAPLFPAELIAQEFTKDRDVDIPGAVLDVYKQWRPAPLVRARRLEQ
ALDTPARIYFKYEGVSPAGSHKPNTAVPQAYYNKLAGVAKLTTETGAGQWGSSLSLACSY
FGLECEVFMVKISYQQKPYRRGLMQTYGATVHASPSELTQAGRDALAADPDNPGSLGLAI
SEAVEAAVVGGDDVKYALGSVLNHVLMHQTIIGQEARLQLELAEDYPDIVIGAAGGGSNF
GGLALPFLREQLEGGRSVRAIAVEPSSCPSLTEGKYDYDFGDTAGLTPLAKMHTLGHDFR
PPAIHAGGLRYHGMAPIISALKEAELLEARAVPQTACFEAGVTFARNEGIVPAPESTHAV
RVAIDEALRAKEEGVSRSILFSLSGHGHFDMQAYADYFAGDLTD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacccgggcaccaaggagccgatcactgagtccgacctggctccgctgttcccg
gcggagctgatagcccaggagttcaccaaggaccgcgacgtcgacatccccggcgccgtg
ctggacgtctacaagcagtggcgccccgcgccgctggtccgggcgcggcgtctggagcag
gctctggacaccccggcgcggatctacttcaagtacgagggcgtgagcccggccggcagc
cacaagccgaacaccgccgtgccgcaggcgtactacaacaagctggccggcgtcgccaag
ctcaccaccgagaccggcgccgggcagtggggcagctcgctgtccctggcctgctcctac
ttcgggctggagtgcgaggtcttcatggtgaagatcagctaccagcagaagccctaccgc
cggggtctgatgcagacctacggcgccaccgtgcacgccagccccagcgagctcacccag
gccggccgcgacgcgctggccgccgacccggacaaccccggcagcctgggcctggccatc
tccgaggcggtcgaggcggccgtggtcggcggcgacgacgtcaagtacgcgctgggctcg
gtgctcaaccacgtgctgatgcaccagacgatcatcggccaggaggcgcggctgcagctg
gagctggccgaggactacccggacatcgtgatcggcgcggccggcggcggctccaacttc
ggcggcctggcgctgccgttcctgcgcgagcagctggagggcggccggtcggtgcgggcc
atcgcggtcgagccctcctcctgcccgagcctgaccgagggcaagtacgactacgacttc
ggcgacaccgccgggctcacgccgctggccaagatgcacaccctcgggcacgacttccgc
ccgccggccatccacgccggcggtctgcgctaccacggcatggcgccgatcatcagcgcc
ctgaaggaggccgagctgctggaggcgcgcgccgtcccgcagaccgcgtgcttcgaggcc
ggcgtgaccttcgcccgcaacgagggcatcgtgccggcgccggagtccacgcacgcggtg
cgggtggcgatcgacgaggcgctgcgggccaaggaggagggcgtgagccggtcgatcctg
ttctcgctgtccgggcacgggcacttcgacatgcaggcctacgccgactacttcgccggc
gatctgacggactga

DBGET integrated database retrieval system