KEGG   Catenulispora acidiphila: Caci_3714Help
Entry
Caci_3714         CDS       T00967                                 

Definition
glucan endo-1,6-beta-glucosidase (EC:3.2.1.75)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cai  Catenulispora acidiphila
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Caci_3714
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Caci_3714
Enzymes [BR:cai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Caci_3714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4176752..4178752)
Genome map
AA seq 666 aa AA seqDB search
MPRRLSALTLIGGLLVAAGAIVPVASAATGQGAGHDTGRGPKPVAAHVWLTTPDGANRLA
DAGTVAFGTVPATVPTVVVDPTLTYQRMQGFGAAITDSSAAVLSNLSPATRTATMRSLFD
PVTGDGLDYLRQPIGGSDFVASAAYTYDDVPAGQTDYAQRDFSIAHDKAQIIPLLRQAKA
INPRLQIVATPWSPPAWMKTGGSLTGGRLIDDPRVYQAYALYLLKFVEAYQAAGVPVDTI
TVQNEPQNRTPSGYPGTDMPSWQEEKVIEDLGPMLRQAHLHTQILAYDHNWTEHPNDVAA
TPPDETADIDAYPQNVLNSPAARWVSGVAFHCYSGDPSAMTAFHNQFPDKAIYFTECSGN
QSSDPANTFSDTLKWHARNLTIGATRNWAETVVNWNLALDPSGGPHVGGCGTCTGVVTVN
PDGTVTDNAEYYTLGHLARFVKPGALRIASTSFGTTGWNGQIMDVAFQNPDGSTALVAHN
ENDNPQTFAVQEGDQNFTYTLPGGALATFTWNAHLPGSTTLRQLDPTGWHASANPPGPTD
PCCSADVAANATDADASTRYSSGTAQAAGQYLQVNFGKAVTARRVVFDTGASTGDYPRGY
SVSTSRDGVSWTTATVSGVGSGQFTTVDLTGAPIRYVRLTLTAANGSWWSVADVRAYTGG
GWSGDK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgaagactctcagcactgactctgatcggcggactcctcgtcgcggccggcgct
atcgtcccggtcgcgtccgccgccaccggccagggcgccgggcacgacaccgggcgcggg
ccgaagcctgtcgccgcgcacgtctggctcaccacccccgacggcgcgaaccggctcgcc
gacgccggcacggtcgccttcgggaccgtgccggccaccgtcccgaccgtcgtggtcgat
ccgactctgacctaccagcggatgcagggcttcggcgcggcgatcaccgattcctccgcg
gcggtgctctcgaacctctcccccgcgacgcgcaccgccaccatgcgctcgctgttcgac
ccggtgaccggcgacggcctggactacctgcgccagccgatcggcggctcggacttcgtc
gcgagcgccgcctacacctacgacgacgtgcccgccggacagacggactacgcgcagcgc
gacttctccatcgcgcacgacaaggcgcagatcatcccgctgctgcggcaggccaaggcg
atcaacccccgcctgcagatcgtcgccacgccgtggagcccgccggcgtggatgaagacc
ggcggctcgctgaccggcggccggctcatcgacgatccgcgcgtctatcaggcctacgcg
ctgtacctgctgaagttcgtcgaggcctaccaggccgccggcgtcccggtcgacaccatc
acggtgcagaacgagccgcagaaccggactccgtcgggctatccgggcactgacatgccc
tcctggcaggaggagaaggtcatcgaggacctcggcccgatgctgcgccaggcgcacctg
cacacgcagatcctcgcctacgaccacaactggaccgagcacccgaacgacgtcgccgcc
accccgccggacgagaccgcggacatcgacgcctacccgcagaacgtgctgaactccccg
gccgccaggtgggtctccggcgtcgcgttccactgctacagcggcgatcccagcgcgatg
accgcgttccacaaccagttcccggacaaggcgatctacttcaccgagtgctccggcaac
cagtcgagcgaccccgcgaacaccttctccgacacactgaaatggcacgccaggaacctg
acgatcggcgccacccgcaactgggccgagacagtagtcaactggaacctggcactggac
cccagcggcggcccgcacgtcggaggctgcggcacctgcaccggcgtcgtcaccgtcaac
ccggacggcaccgtcacggacaatgcggagtactacaccctcggacacctggcacgcttc
gtgaagccgggagcgctgcgcatcgccagcacatccttcggcacgaccggctggaacggc
cagatcatggacgtcgcattccagaacccggacggcagcaccgcactcgtcgcccacaac
gagaacgacaacccccagaccttcgcagtccaggagggcgaccagaacttcacctacacc
ctgcccggcggcgccctggccaccttcacctggaacgcacacctccccggcagcaccacc
ctgcgccaactcgaccccaccggctggcacgcctccgcgaaccccccaggcccgaccgac
ccctgctgctccgccgacgtagcggccaacgccacagacgccgacgccagcacccgctac
tcctcaggcacagcccaggcagcaggccagtacctgcaggtcaacttcggcaaggccgtc
accgcacgccgcgtcgtattcgacaccggcgcctccaccggcgactacccgcgcggctac
agcgtgagcaccagcagggacggcgtctcatggacgacggctaccgtgtcgggggttggc
agcggccagttcacgacggtggatctgaccggcgcgccgatccggtacgtccgtctaacg
cttactgcggctaacggaagctggtggagcgtcgccgatgtgcgcgcgtacaccggcgga
gggtggtcgggcgacaaatag

DBGET integrated database retrieval system