KEGG   Catenulispora acidiphila: Caci_4214Help
Entry
Caci_4214         CDS       T00967                                 

Definition
(GenBank) glycoside hydrolase family 5
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
cai  Catenulispora acidiphila
Pathway
cai00500  Starch and sucrose metabolism
cai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Caci_4214
Enzymes [BR:cai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Caci_4214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase CBM_2 fn3
Motif
Other DBs
NCBI-ProteinID: ACU73078
JGI: Caci_4214
UniProt: C7QI33
Position
complement(4776901..4778727)
Genome map
AA seq 608 aa AA seqDB search
MAAALIAASVMTFAGVAAQPATARTDAAAAHTTAATAGTTGTAPAATAAAGAGYWHTSGR
EILDSANQPVRIAGVNWFGFETSNDVVHGLWSRDYKSMMDQMKSLGYNTIRLPYSDDIFK
PGTMPNSINFYQMNTDLQGLTSLQVMDKIVDYAGSIGLKVILDRHRPDAGGQSALWYTST
VPESTWINDLKAIATRYQGNPAVVGIDLHNEPHDPACWGCGDTTIDWRLAAERGGNAVLS
VNPSLLIFVEGVQTFNGSSYWWGGNLQGAGQYPVQLSVANRVVYSAHDYATSVASQPWFT
DPSFPSNMAGIWDKNWGYLFNQNIAPVWVGEFGTTLSATTDQVWLKTLVSYLRPTSTYGG
DSYQWTFWSWNPDSGDTGGILKDDWNSVDTVKDGYLTSIKAPAFGGGGGGGGGDSSPPTA
PTNVAATVTTSSSVALSWTASTDNVGVTGYDIYRGSTLAGTSAGTTFTDSGLTPSTAYTY
TVKAYDAAGNLSAASAAVSATTQGGGSNAGCTAAYTVSNQWNNGFTAAVTITNSGTAATH
SWKVTWTWPGGQQVSNAWNATEAHSGQSETFTAVSSDAVVAPGGTTSFGFQASYNGTNPA
PTPVCTAS
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggcgttgatcgcggcgtcggtcatgaccttcgccggggtggccgcgcagccg
gccaccgcgcgcaccgatgccgccgccgcccacaccaccgccgccaccgccggcaccacc
ggcaccgccccggccgcgacagcggcggcaggcgccggatactggcacaccagcggccgg
gagatcctggactcggccaaccagccggtccgcatcgccggcgtcaactggttcggcttc
gagaccagcaacgacgtcgtccacggcctgtggagccgggactacaagtcgatgatggac
cagatgaaatcgctgggctacaacacgatccggctgccctacagcgacgacatcttcaag
cccggcacgatgccgaacagcatcaacttctaccagatgaacaccgacctgcagggtctg
acctcgctgcaggtgatggacaagatcgtggactacgccggctcgatcggcctgaaggtg
attttggaccgccaccgtccggacgccggcgggcagtcggcgctgtggtacacctccaca
gtcccggaatcgacgtggatcaacgacctgaaagccatcgccacgcgctaccagggcaac
ccggcggtggtcgggatcgacctgcacaacgagccgcacgacccggcgtgctggggctgc
ggggacaccacgatcgactggcggctggccgccgagcgcggcggcaacgcggtgctgtcc
gtcaaccccagcctgttgatcttcgtcgagggtgttcagaccttcaacggcagctcctac
tggtggggcggcaacctacagggcgccgggcagtatccggtgcagctgtcggtggccaac
cgggtcgtctactcggcccacgactacgccaccagcgtggccagccagccgtggttcacc
gacccgagcttcccctccaacatggccgggatctgggacaagaactggggctacctgttc
aaccagaacatcgcccccgtgtgggtcggcgagttcggcacgacgctgtccgccacgacc
gaccaggtctggctcaagacgctggtctcctacctgcgtccgaccagcacctacggcggc
gactcctaccagtggacgttctggtcctggaacccggactccggtgacaccggcggcatc
ctgaaggacgactggaactcggtggacaccgtcaaggacggctatttgacctcgatcaag
gcaccggccttcggcggcgggggcggcggaggcggaggcgacagctcgccgccgaccgcg
ccgaccaacgtggcggcgaccgtcaccacctccagctcggtagcgctgtcctggaccgcc
tcgaccgacaacgtcggcgtcaccggctatgacatctaccggggcagcaccctcgccgga
acgtcggcgggcacgacgttcaccgacagtggactgacaccctcgaccgcgtacacctac
acggtcaaggcgtacgacgcagccggcaacctgtcggcggcctcggccgcggtgtccgcg
acgacgcagggcggcggcagcaacgccggctgcaccgcggcgtacacggtgtcgaaccag
tggaacaacggcttcaccgccgcggtcacgatcaccaactccggaaccgcggcgacccac
agctggaaggtcacctggacgtggccgggcggccagcaggtcagcaacgcctggaacgcc
accgaagcccacagcgggcagagcgagacgttcaccgcggtgagctccgacgcggtggtc
gcgccgggaggcacgacgtcgttcggattccaggcgagctacaacgggaccaacccggca
ccgactccagtgtgcacagcgagctga

DBGET integrated database retrieval system