KEGG   Catenulispora acidiphila: Caci_4214Help
Entry
Caci_4214         CDS       T00967                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cai  Catenulispora acidiphila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Caci_4214
Enzymes [BR:cai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Caci_4214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4776901..4778727)
Genome map
AA seq 608 aa AA seqDB search
MAAALIAASVMTFAGVAAQPATARTDAAAAHTTAATAGTTGTAPAATAAAGAGYWHTSGR
EILDSANQPVRIAGVNWFGFETSNDVVHGLWSRDYKSMMDQMKSLGYNTIRLPYSDDIFK
PGTMPNSINFYQMNTDLQGLTSLQVMDKIVDYAGSIGLKVILDRHRPDAGGQSALWYTST
VPESTWINDLKAIATRYQGNPAVVGIDLHNEPHDPACWGCGDTTIDWRLAAERGGNAVLS
VNPSLLIFVEGVQTFNGSSYWWGGNLQGAGQYPVQLSVANRVVYSAHDYATSVASQPWFT
DPSFPSNMAGIWDKNWGYLFNQNIAPVWVGEFGTTLSATTDQVWLKTLVSYLRPTSTYGG
DSYQWTFWSWNPDSGDTGGILKDDWNSVDTVKDGYLTSIKAPAFGGGGGGGGGDSSPPTA
PTNVAATVTTSSSVALSWTASTDNVGVTGYDIYRGSTLAGTSAGTTFTDSGLTPSTAYTY
TVKAYDAAGNLSAASAAVSATTQGGGSNAGCTAAYTVSNQWNNGFTAAVTITNSGTAATH
SWKVTWTWPGGQQVSNAWNATEAHSGQSETFTAVSSDAVVAPGGTTSFGFQASYNGTNPA
PTPVCTAS
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggcgttgatcgcggcgtcggtcatgaccttcgccggggtggccgcgcagccg
gccaccgcgcgcaccgatgccgccgccgcccacaccaccgccgccaccgccggcaccacc
ggcaccgccccggccgcgacagcggcggcaggcgccggatactggcacaccagcggccgg
gagatcctggactcggccaaccagccggtccgcatcgccggcgtcaactggttcggcttc
gagaccagcaacgacgtcgtccacggcctgtggagccgggactacaagtcgatgatggac
cagatgaaatcgctgggctacaacacgatccggctgccctacagcgacgacatcttcaag
cccggcacgatgccgaacagcatcaacttctaccagatgaacaccgacctgcagggtctg
acctcgctgcaggtgatggacaagatcgtggactacgccggctcgatcggcctgaaggtg
attttggaccgccaccgtccggacgccggcgggcagtcggcgctgtggtacacctccaca
gtcccggaatcgacgtggatcaacgacctgaaagccatcgccacgcgctaccagggcaac
ccggcggtggtcgggatcgacctgcacaacgagccgcacgacccggcgtgctggggctgc
ggggacaccacgatcgactggcggctggccgccgagcgcggcggcaacgcggtgctgtcc
gtcaaccccagcctgttgatcttcgtcgagggtgttcagaccttcaacggcagctcctac
tggtggggcggcaacctacagggcgccgggcagtatccggtgcagctgtcggtggccaac
cgggtcgtctactcggcccacgactacgccaccagcgtggccagccagccgtggttcacc
gacccgagcttcccctccaacatggccgggatctgggacaagaactggggctacctgttc
aaccagaacatcgcccccgtgtgggtcggcgagttcggcacgacgctgtccgccacgacc
gaccaggtctggctcaagacgctggtctcctacctgcgtccgaccagcacctacggcggc
gactcctaccagtggacgttctggtcctggaacccggactccggtgacaccggcggcatc
ctgaaggacgactggaactcggtggacaccgtcaaggacggctatttgacctcgatcaag
gcaccggccttcggcggcgggggcggcggaggcggaggcgacagctcgccgccgaccgcg
ccgaccaacgtggcggcgaccgtcaccacctccagctcggtagcgctgtcctggaccgcc
tcgaccgacaacgtcggcgtcaccggctatgacatctaccggggcagcaccctcgccgga
acgtcggcgggcacgacgttcaccgacagtggactgacaccctcgaccgcgtacacctac
acggtcaaggcgtacgacgcagccggcaacctgtcggcggcctcggccgcggtgtccgcg
acgacgcagggcggcggcagcaacgccggctgcaccgcggcgtacacggtgtcgaaccag
tggaacaacggcttcaccgccgcggtcacgatcaccaactccggaaccgcggcgacccac
agctggaaggtcacctggacgtggccgggcggccagcaggtcagcaacgcctggaacgcc
accgaagcccacagcgggcagagcgagacgttcaccgcggtgagctccgacgcggtggtc
gcgccgggaggcacgacgtcgttcggattccaggcgagctacaacgggaccaacccggca
ccgactccagtgtgcacagcgagctga

DBGET integrated database retrieval system