KEGG   Catenulispora acidiphila: Caci_4251Help
Entry
Caci_4251         CDS       T00967                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cai  Catenulispora acidiphila
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Caci_4251
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Caci_4251
Enzymes [BR:cai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Caci_4251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4825931..4827517
Genome map
AA seq 528 aa AA seqDB search
MFRRARLALLAAGVALGMTVTGAAGAAGASSSAAAAASFPNVVVPVPVSETANGSTFTLA
SAATLTADDANVGGYLAGILRASTGYALPLTVGAAAPGTIALSLSGAPATVGAEGYQLTI
KASSVLLQANSAAGLFHGVQTLLQLLPAQVMSPAKVTSVAWKATGGTILDYPRFGYRGAM
LDVARHFFTVAQVEHYIDELSLYKVNYLHLHLSDDQGWRIAINSWPNLATTGGSTEVGGG
AGGYYTQADYTTIVNYAASHYMTLVPEIDTPGHTNAALASYAALNCNGVAPPLYTGTDVG
FSSLCVSLPLTYTFLDQVVGELAALTPGPYIHIGGDEASSTSQSDYTSFITKAQQIVGNH
GKAVMGWHNIAAATLAPSTLAQFWDTTKSNSALAAAAAKGTKIVMSPANHAYLDMKYTKK
TTLGQNWAGYVDVNAAYGWDPGNYLSGVSASAIAGVEAPLWSETLVTSANIDYMAFPRLP
ALMELGWSPESTHNQTSFDARLGAQGPRWHAMGVDYYKSTQVKWPSGS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttccggcgcgcgcggctggcgctgctggcggccggggtcgcgctcggcatgaccgtg
accggtgcggccggcgcggccggggcttcgtcctcggccgctgccgccgcctcgttcccg
aacgtcgtggtcccggtgccggtgtcggagaccgcgaacggctcgaccttcacgctcgcc
tcggcggcgacgctgacggccgacgacgcgaacgtcggcggctacctggccgggatcctg
cgggcctcgaccgggtacgcactgccgcttaccgtcggcgccgcggcgcccggcacgatc
gcgctgtccctgtccggtgcgccggccacggtcggcgccgaggggtatcagctcacgatc
aaggcgagctcggtgctgctccaggcaaactcggcggcggggttgttccacggcgtgcag
acgttgctgcaactgctgccggctcaggtgatgagcccggcgaaggtgacttcggtggcg
tggaaggcgaccggcggcacgatcctggactatccgcgcttcgggtatcgcggggcgatg
ctggacgtggcgcggcacttcttcaccgtcgcgcaggtcgagcactacatcgacgaactg
tcgctgtacaaggtgaactacctgcatctgcacctgtcggacgaccagggatggcgcatc
gcgatcaactcctggccgaacctggcgaccaccggcggctccaccgaggtcggaggcggc
gccggcggctactacacgcaggcggactacaccacgatcgtgaactacgccgcgtcgcac
tacatgacgctggtccccgagatcgacacgccgggtcacacgaacgccgcgctcgcctcg
tacgcggccttgaactgcaacggggtcgcgccgcctctgtacaccgggaccgacgtcggc
ttcagctcgctgtgcgtctcgctgccgctgacgtacacgttcctggaccaggtcgtcggc
gagctcgcggcactgactccgggcccttacatccacatcggcggcgacgaggccagctcc
acgtcgcagagcgactacacgtccttcatcaccaaggcgcagcagatcgtgggcaaccac
ggcaaggcggtcatgggctggcacaacatcgccgcggccaccctggcgccgtccacgctc
gcgcagttctgggacacgacgaagtcgaactccgcgctggctgccgcggcggctaagggc
acgaagatcgtcatgtccccggcgaaccacgcctacctggacatgaagtacaccaagaag
acgacgctgggccagaactgggccggctacgtcgacgtcaacgcggcctacggctgggac
ccggggaactacctgtcaggcgtcagcgcctcggcgatcgccggcgtcgaggcgccgctg
tggtccgagacgctcgtcacgtcggcgaacatcgactacatggccttcccgcgccttccc
gcgctgatggagctcggatggtcgcccgaatcgacccacaaccagacgtcgttcgacgcc
cggctcggcgcgcagggaccccggtggcacgcgatgggggtggattactacaagtcgacg
caggtcaagtggccgagcgggtcgtga

DBGET integrated database retrieval system