KEGG   Catenulispora acidiphila: Caci_4369Help
Entry
Caci_4369         CDS       T00967                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
cai  Catenulispora acidiphila
Pathway
cai00010  Glycolysis / Gluconeogenesis
cai00052  Galactose metabolism
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
cai01120  Microbial metabolism in diverse environments
cai01130  Biosynthesis of antibiotics
Module
cai_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caci_4369
   00052 Galactose metabolism
    Caci_4369
Enzymes [BR:cai01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Caci_4369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACU73233
JGI: Caci_4369
UniProt: C7QJZ5
Position
4960560..4961678
Genome map
AA seq 372 aa AA seqDB search
MRSSALRPFGILPDGTAVDSWRLTDSSGAQATILAYGATLQELTTPDRDGRIANVVLGFS
ELSDYIERAAYYGCVVGRYANRIAGGTFALDGREIRLPLNDGPRPNTLHGGTPGFGARLW
TAPDGIVEVGDANGADGAAGADGAAGTSLTLTRVSPDGEEGFPGELTVSIRYTLAAGRLT
LDYRAETTAPTVLNLSNHARFNLAGEGVGNVLDHELTVAADGFLPVDEALIPLDGAAPVA
GTPFDFRTPTPVGARLADPHPQLETVGGYDHCFVLRGGRTAVPRPVVTLRDPASGRTMQI
ATTEPGLQLYLSSELDGTLTGLGGRPYEQYGGIVLETQHFPDSPHRPDYPSTVLLPGRSF
TSTTVYAFGVRT
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
ttgcgatcttcagccctccgacctttcggcatcctgcccgacggcaccgcggtcgacagc
tggcggctgaccgactcctccggagcccaggccacgatcctcgcctacggcgccaccctg
caggaactcacgacgccggatcgtgacggtcggatcgccaacgtcgtcctcggattctcc
gagttgtcggactacatcgagcgcgccgcgtattacggctgtgtcgtcggacgctacgcc
aatcggatagccggcggcaccttcgccctcgacggccgcgagatccgcctgccgctcaac
gacggcccgcgtcccaacaccctgcacggcggcacgcccggcttcggcgcccgcctgtgg
accgcgccggacggcatcgtcgaggtcggcgacgcgaacggtgccgacggtgctgccggt
gccgacggcgccgctggcacctcgctcaccctcacccgcgtcagccccgacggcgaggag
ggcttccccggcgagctcaccgtcagcatccgctacaccctcgccgccggccgcctcacc
ctggactaccgcgccgagaccaccgccccgaccgtgctgaacctgtccaaccacgcccgc
ttcaacctcgccggcgagggcgtcggcaacgtcctggaccacgaactgaccgtcgccgcc
gacggcttcctcccggtcgacgaggcgctgatcccgctcgacggcgccgccccggtcgcc
ggcacccccttcgacttccgcaccccgaccccggtcggcgcgcgcctggccgacccgcac
ccgcagctggaaaccgtcggcggatacgaccactgcttcgtcctgcgcggcggacgcaca
gcggtcccgcgccccgtcgtcacgctccgcgacccggccagcggccgcacgatgcagatc
gcgacgaccgaaccgggcctgcagctctacctctcctccgagctcgacggcacgctgacc
ggcctcggcgggcgcccgtatgagcaatacggcggcatcgtgctggagacccagcacttt
cccgactccccgcaccgtcccgactacccctcgacagtgctcctaccagggcgttccttc
acttcgacgacggtctacgccttcggcgtccgcacttga

DBGET integrated database retrieval system