KEGG   Catenulispora acidiphila: Caci_4512Help
Entry
Caci_4512         CDS       T00967                                 

Definition
glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cai  Catenulispora acidiphila
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Caci_4512
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Caci_4512
Enzymes [BR:cai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Caci_4512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5137782..5139230)
Genome map
AA seq 482 aa AA seqDB search
MSELDVVIARVLQPGFVGTSPPDWLRRRLAGGLGSVILFAANMESPEQARTLTNELRAEN
PDVFVAVDEEAGDITRLEAATGSSYPGNLALGAIDDIALTEATARSIGALVHSAGIDLTY
APVADVNTEPRNPVIGARSFGADPALVARHVAATVRGLHTAGVAACAKHFPGHGDTVIDS
HFGLPTVTATLEQLRHDTLPPFSAAVAAGVRAVMVAHLLMPEFDTEHPASVSPAVIGGLL
RTELGFDGLAVSDAIGMAAVRERYGLASAAVRALVAGIDMVCVDSDSTDADLAAITDAIT
AALRDGTLSEARLVEAAEKVAGFAAWRREARDASVSVFDAPLGDGLAAARRAVAVLRADD
GALPLKSAPHVVEVDLPRSMADHLATLLPGTTNSKLSDTIDAAAATGSFAIPADQPLVVV
VRGIQRSPEDLDRVARLVKERPDAIVVDLGVAHIDPGGAAWVAGYGVSRVSLQAVAEVLA
GR
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagctcgatgtggtgatcgcccgcgtgctgcagccggggttcgtgggaacgtca
ccgccggactggctgcggcggcggctggccggcgggctgggatcggtgattctgttcgcg
gcgaacatggagtcgccggagcaggcgcggacgctgaccaacgagctgcgcgctgagaat
ccggacgtgttcgtggctgtggacgaggaagccggggacatcacccggctggaagccgcc
accggctcctcctaccccgggaacctggcactcggcgcgatcgacgacatcgcgctgacc
gaggccacggcccgctcgatcggcgccctggtgcactcggcggggatcgacctgacctac
gcaccggtcgccgacgtgaacaccgagccgcgcaacccggtcatcggcgcacgctccttc
ggcgccgaccccgcactggtcgcacggcacgtcgcggcgacagtgcggggactgcacacg
gcgggcgtcgcggcatgcgcgaagcacttccccggccacggcgacaccgtgatcgactcg
cacttcggactcccgaccgtcaccgcgacactggagcaactccgccacgacaccctgccg
ccgttcagcgcggcggtggccgccggcgtgcgggcggtgatggtcgcgcacctgctgatg
ccggagttcgacaccgagcaccccgcatcggtgagcccggcggtgatcggcggactgctg
cgaaccgagctcggcttcgacggcctggcagtcagcgacgcgatcggcatggcggcggtc
cgcgagcgctacgggctcgccagcgcggcggtgcgcgcactggtcgcggggatcgacatg
gtctgcgtggacagcgactccaccgacgccgacctggctgcgatcacggacgcgatcacc
gcggcgctgcgagacgggacgctgagcgaggcgcggttggtggaggctgctgagaaggtg
gcgggtttcgccgcgtggcgacgggaggctcgggacgcttcggtttctgtgtttgatgcg
ccactcggcgacggactcgcagcagcacgccgcgcggtcgcggtgctgcgtgcggacgac
ggtgcgctgccactgaaatcagcgccgcatgtggtggaggtggatctcccccgaagcatg
gccgaccacctggccacgctgctgcccggaaccaccaactcaaagctctccgacacgatc
gacgccgccgctgcgaccggcagctttgctatccccgccgaccaacccttggtcgtcgtc
gtccgcggcatccagcgctcccccgaggacctggaccgcgtggcccgcctcgtgaaggag
cgccccgacgcgatcgtcgtcgacctcggcgtcgcgcacatcgaccctggcggcgcggcg
tgggtcgcagggtacggcgtctcgcgcgtgagcctgcaggctgtggcggaggtccttgcc
ggcaggtag

DBGET integrated database retrieval system