KEGG   Catenulispora acidiphila: Caci_4693Help
Entry
Caci_4693         CDS       T00967                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
cai  Catenulispora acidiphila
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Caci_4693
  Lipid metabolism
   00561 Glycerolipid metabolism
    Caci_4693
   00600 Sphingolipid metabolism
    Caci_4693
Enzymes [BR:cai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Caci_4693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5349195..5350526)
Genome map
AA seq 443 aa AA seqDB search
MIRIAFVGAGSVVFTRQLLHDILSYPELSGAAIALHDIDPERLQVAAALADHAARTLGAE
VSVTATTDRRAALAGADAVVNMIAVGGHQATVTDFEIPAAAGLRQTIGDTLGVGGIFRAL
RTFPVLRSLAQDMAEVCPDAWLLNYTNPMAMNIQYLSTIAPKLKVAGLCHSVYWTVRGLC
DIIGIPHDDVDVLSAGVNHQAWILRWQHQGRDLYPALDAAIAASPDLARRVRVDMYQRLG
YYPTETSEHSSEYVPWYLGHDTEITRLRIPVGDYIDISAENLAEYRELRKVITDGGDPAN
GWESDAAEYAPQVIHSLATGTPRTIQVTTPNTGLISNLPEAAAVEVPATLDRLGIHPHHV
GALPPQLAAPNRHFLNVVDLVVAAAVEGDPRHIRHAAMADPATAATLTVDQIWNLCDAMV
TAHGDALPEPLRRSPLAARGGGG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgcatcgccttcgtcggcgccggctcggtggtcttcacccggcagctgctgcac
gacatcctgtcctaccccgagctgtccggcgcggccatcgcgctgcacgacatcgacccc
gagcggctgcaggtcgccgccgcgctggccgaccacgccgcgcgcaccctcggcgccgag
gtgtccgtcacggccaccaccgaccgccgcgccgccctggccggcgccgacgccgtcgtc
aacatgatcgccgtcggcggccaccaggccaccgtcaccgacttcgagatccccgccgcc
gccggcctgcgccagaccatcggcgacaccctcggcgtcggcggcatcttccgcgccctg
cgcaccttcccggtcctgcgatccctggcgcaggacatggccgaggtctgccccgacgcc
tggctgctgaactacaccaaccccatggccatgaacatccagtacctgagcacgatcgcg
ccgaagctgaaggtcgcaggcctgtgccactcggtgtactggaccgtccgcggcctgtgc
gacatcatcggcatcccccacgacgacgtcgacgtcctgtccgccggcgtgaaccaccaa
gcctggatcctgcgctggcagcaccaaggccgcgacctctacccggccctggacgccgcc
atagcagccagcccggacctggcccgccgcgtccgcgtcgacatgtaccagcgcctcggc
tactacccgaccgagaccagcgagcactcctccgaatacgtcccctggtacctcggccac
gacaccgaaatcacccgcctccgcatccccgtaggcgactacatcgacatcagcgccgaa
aacctcgccgaataccgcgaactccgcaaagtcatcaccgacggcggcgaccccgccaac
ggctgggaaagcgacgccgccgaatacgccccccaagtcatccacagcctagccaccggc
accccccgcaccatccaagtcaccacccccaacaccggcctgatcagcaacctccccgaa
gcagccgccgtcgaagtcccagcaaccctcgaccgcctcggcatccacccccaccacgta
ggagcactcccaccccaactagcagcccccaaccgccacttcctcaacgtagtcgaccta
gtagtagccgccgccgtagaaggcgacccccgccacatccgccacgccgcaatggcagac
cccgccacagccgcaaccctgaccgtcgaccagatctggaacctctgcgacgccatggtc
accgcccacggagacgcactgccggagccattgcggcggagcccgctcgcggcgcggggc
ggtggggggtga

DBGET integrated database retrieval system