KEGG   Catenulispora acidiphila: Caci_4693Help
Entry
Caci_4693         CDS       T00967                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
cai  Catenulispora acidiphila
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cai00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cai00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cai00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5349195..5350526)
Genome map
AA seq 443 aa AA seqDB search
MIRIAFVGAGSVVFTRQLLHDILSYPELSGAAIALHDIDPERLQVAAALADHAARTLGAE
VSVTATTDRRAALAGADAVVNMIAVGGHQATVTDFEIPAAAGLRQTIGDTLGVGGIFRAL
RTFPVLRSLAQDMAEVCPDAWLLNYTNPMAMNIQYLSTIAPKLKVAGLCHSVYWTVRGLC
DIIGIPHDDVDVLSAGVNHQAWILRWQHQGRDLYPALDAAIAASPDLARRVRVDMYQRLG
YYPTETSEHSSEYVPWYLGHDTEITRLRIPVGDYIDISAENLAEYRELRKVITDGGDPAN
GWESDAAEYAPQVIHSLATGTPRTIQVTTPNTGLISNLPEAAAVEVPATLDRLGIHPHHV
GALPPQLAAPNRHFLNVVDLVVAAAVEGDPRHIRHAAMADPATAATLTVDQIWNLCDAMV
TAHGDALPEPLRRSPLAARGGGG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgcatcgccttcgtcggcgccggctcggtggtcttcacccggcagctgctgcac
gacatcctgtcctaccccgagctgtccggcgcggccatcgcgctgcacgacatcgacccc
gagcggctgcaggtcgccgccgcgctggccgaccacgccgcgcgcaccctcggcgccgag
gtgtccgtcacggccaccaccgaccgccgcgccgccctggccggcgccgacgccgtcgtc
aacatgatcgccgtcggcggccaccaggccaccgtcaccgacttcgagatccccgccgcc
gccggcctgcgccagaccatcggcgacaccctcggcgtcggcggcatcttccgcgccctg
cgcaccttcccggtcctgcgatccctggcgcaggacatggccgaggtctgccccgacgcc
tggctgctgaactacaccaaccccatggccatgaacatccagtacctgagcacgatcgcg
ccgaagctgaaggtcgcaggcctgtgccactcggtgtactggaccgtccgcggcctgtgc
gacatcatcggcatcccccacgacgacgtcgacgtcctgtccgccggcgtgaaccaccaa
gcctggatcctgcgctggcagcaccaaggccgcgacctctacccggccctggacgccgcc
atagcagccagcccggacctggcccgccgcgtccgcgtcgacatgtaccagcgcctcggc
tactacccgaccgagaccagcgagcactcctccgaatacgtcccctggtacctcggccac
gacaccgaaatcacccgcctccgcatccccgtaggcgactacatcgacatcagcgccgaa
aacctcgccgaataccgcgaactccgcaaagtcatcaccgacggcggcgaccccgccaac
ggctgggaaagcgacgccgccgaatacgccccccaagtcatccacagcctagccaccggc
accccccgcaccatccaagtcaccacccccaacaccggcctgatcagcaacctccccgaa
gcagccgccgtcgaagtcccagcaaccctcgaccgcctcggcatccacccccaccacgta
ggagcactcccaccccaactagcagcccccaaccgccacttcctcaacgtagtcgaccta
gtagtagccgccgccgtagaaggcgacccccgccacatccgccacgccgcaatggcagac
cccgccacagccgcaaccctgaccgtcgaccagatctggaacctctgcgacgccatggtc
accgcccacggagacgcactgccggagccattgcggcggagcccgctcgcggcgcggggc
ggtggggggtga

DBGET integrated database retrieval system