KEGG   Catenulispora acidiphila: Caci_4737Help
Entry
Caci_4737         CDS       T00967                                 

Definition
(GenBank) urate oxidase
  KO
K00365  urate oxidase [EC:1.7.3.3]
Organism
cai  Catenulispora acidiphila
Pathway
cai00230  Purine metabolism
cai01100  Metabolic pathways
cai01120  Microbial metabolism in diverse environments
Module
cai_M00546  Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Caci_4737
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Caci_4737
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Caci_4737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Uricase
Motif
Other DBs
NCBI-ProteinID: ACU73598
JGI: Caci_4737
UniProt: C7PZT3
Position
complement(5403937..5404800)
Genome map
AA seq 287 aa AA seqDB search
MSIVLGDNRYGKCENRIVRITKQGPVHQIKDITVSVALSGDLDATHLTGDNSGVLPTDTM
KNTCFAFAQRHGAVEIEEYALLLARHFVDSQPSIGHARVEVDEHAWDRIGQGPHSFVRTG
GGTRTCTVHYDGTAAWVLSGVKDLTVLNSTDSEFWGYVKDEYTTLAEAHDRVLATEIHAQ
WRHAAASGDWGKSYERAKTALLEAFVRTHSRSLQQTLFEMGTRVLEESPELCEVRLKLPN
KHHFRYDTAPFGLDNPNETFLAADRPYGLIEGDVRRDDAPAAGPAWT
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgtcttgggggacaaccgttacggcaagtgcgagaaccggattgtccggatc
accaagcagggtccggtgcaccagatcaaggacatcaccgtctcggtcgcgctgtccggc
gatctggacgcgacccacctgaccggtgacaactccggcgtgctgccgaccgacaccatg
aagaacacgtgcttcgccttcgcgcagcgccacggcgcggtcgagatcgaggagtacgcg
ctgctgctggcgcggcacttcgtcgactcccagccgagcatcggccatgcccgcgtcgag
gtggacgagcacgcctgggaccgcatcgggcagggtccgcactccttcgtccgcaccggc
ggcggcacccggacctgcaccgtgcactatgacggcaccgcagcctgggtcctctcgggt
gtgaaggacctgaccgtcctgaactccaccgactcggagttctggggctacgtcaaggac
gagtacacgacgctggccgaagcccacgaccgcgtcctggccacggagatccacgcgcag
tggcggcacgccgccgcctccggcgactggggcaaatcctacgagcgcgccaagaccgcg
ctgctggaggcgttcgtgcgaacgcacagccgctcgctgcaacagacgctgttcgagatg
ggcacccgggtcttggaggagagcccggaactgtgcgaggtccggctgaagctgccgaac
aagcaccacttccgctacgacacggcgccgttcggcctggacaacccgaacgagaccttc
ctcgccgcggaccgtccctacggcctcatcgaaggcgacgtccgccgcgacgacgccccc
gccgccggtccggcctggacctga

DBGET integrated database retrieval system