KEGG   Catenulispora acidiphila: Caci_4941Help
Entry
Caci_4941         CDS       T00967                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cai  Catenulispora acidiphila
Brite
Enzymes [BR:cai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Caci_4941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5641162..5642304)
Genome map
AA seq 380 aa AA seqDB search
MSLFDRRAVVAAGCEVDYTDHMRHRRGLLTTLCVVLLAAFGMFLPSTASASTLCNSQTGS
NNGYYYSFWTEGSGSACMTLGSGSNYSTSWSNAGNFVAGEGWSTGGRRTVNYSGSFNPSG
NGYLSLYGWTTNPLVEYYITDSWGSYRPTGTYKGTVTSDGGTYDIYETTRYNAPSIIGTA
TFNQYWAVRQAKRVGGTITTGNFFDAWASHGMNMGQYNYMILATEGYQSSGNSNITVDSS
NGGGGGGGGTTGALHAVGAGKCLDVPNSSTTPGTQPQIYSCNGQSNQTWTRTSSGQLTVT
MNGTTLCLDAYNHQTSPGTKVETWSCNGGANQQWNLNSDGTVTGVQSGLCLDVNGASTAN
GALVQLWTCSGAANQKWTLG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgttcgatcgccgcgccgtggtcgccgccggatgcgaggtcgactacaccgac
cacatgcgccatagaagagggctcctgacgaccctgtgcgttgtgctcctggcggcgttc
gggatgttcctgccgagcacggccagcgcctcgaccctgtgcaacagccagaccggtagc
aataacggctactactactcgttctggaccgagggcagtggttcggcctgcatgacgctc
ggctccggcagcaactacagcacctcctggagcaacgccggaaacttcgtcgccggcgag
ggctggagtaccggcggacgccggaccgtgaactactccgggagcttcaacccttccggg
aacggttacctgtcgctgtacggctggaccaccaacccgctggtcgagtactacatcacc
gacagttggggcagctaccggccgaccggtacctacaagggcacggtcaccagtgacggc
ggcacctacgacatctacgagacgacgcggtacaacgccccctccatcatcggcacggcg
acgttcaaccagtactgggccgtccggcaggccaagcgggtgggcggcaccatcaccacc
ggcaacttcttcgacgcctgggccagccacggcatgaacatgggccagtacaactacatg
atcctggccaccgagggctaccagagcagcggcaactcgaacatcaccgtcgattcctcg
aacggtggcggtggcggcggaggcggcacgacaggcgcgctgcacgcggtcggcgcgggc
aagtgcctggacgtccccaactcctcgacgaccccgggcacccagccgcagatctactcc
tgcaacggccagagcaaccagacctggacccgcacctcgtccggccagctgaccgtcacc
atgaacgggaccaccctgtgtctggacgcctacaaccaccagacctcgcccggcaccaag
gtggagacctggtcctgcaacggcggcgcgaaccagcagtggaacctcaactccgacggc
acggtcaccggagtgcagtcagggctctgtctggacgtcaacggagcgagtaccgcgaac
ggcgccttggtccagctgtggacctgcagcggcgccgccaatcagaaatggacgttgggg
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system