KEGG   Catenulispora acidiphila: Caci_4961Help
Entry
Caci_4961         CDS       T00967                                 

Definition
glycoside hydrolase family 2
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cai  Catenulispora acidiphila
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cai00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cai00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cai00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5666457..5669513)
Genome map
AA seq 1018 aa AA seqDB search
MAERYFEDFSPGHGAAPARAAVDSDAARLDLTGEWAFRFSPILVAEPDGFEEPEFDDADW
DRLAVPSHWQLHGYGHPAYLNISYPIPVDPPFVPDENATGDYRREFELPASWKGGPAVVR
FEGVDSCARVWLNGVELGVSRGSRLPVEFEASAALRAGRNVLAVRVHQYSSGTYLEDQDT
WRMSGIFREVSVVARPDGGLRDVFVHADFDAVTGGGRLRIEADAAGPARVSIAGLDVHDL
PADGVFEFDRVRPWSAEDPYLYEAVISTDEEQVRVRLGFRSIAITESGVLTVNGRRIVLR
GVNRHEFDPDGGRVLTREAMRADVELMKQHNINAVRTSHYPPHPYFLDLCDELGLWVVLE
CDLETHGFENADTVRWDRNPSDDPRWRAAYLDRIARTVERDKNHPSVILWSLGNEAGEGV
NLEAMAAWTRERDPSRPIHYEADHFARFTDVYAQMYRTPADVARIGRGELRPGESFYPAA
DGEGDPADEPRNQMPFLLTEFGHAMGNGPGALAEYTRLWDRYPRLQGGFIWEWMDQGLRT
ADARGREFFAYGGDFGEDLHDGNFICDGLVFPDRTPSPGLLEYRKVIEPVRIEPSRIAPG
ENSASVKIENRYDVIDTSHLRFTWSVERNGIEAAEGVLPVPPLAPGESVDVAVPVPAEPP
TAEGGEFWLTVRADLVAKTAWADEGHPIAWGQTQLASNLEPVLAPEPAPVGAAVHPVRAE
HHITLGPGLFDPDSGTLLSLAGQPVHGPRLDLWRAPTDNDRGWPQHDAEYWHSRGLHRLR
HRTVSLHVADDALTVVVRSAAAASVSGYLTTYRWQAEGENLRVRVRTEPVGRWPERGDVF
GEAMVDPALPPDQYAELVRRDKAPSLARLGLRWLLPARWSQVSWFGAGPGEAYPDSRCAA
RIGRFDATVDQLQIPYVRPQENGNRMETRWIELTDPAGTGVRVEGDPVFNFAARRWSDQA
LAAARHQSDLTPDTSIHLHTDHAVQGLGSAAVGPGVLPQHRLELGSAEFAFTLTPIAG
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcggtatttcgaggatttctcaccgggtcacggtgctgctccggcccgtgcc
gcggtggactccgatgccgctcggctggatctgaccggtgagtgggccttccggttctcg
ccgatcttggtggcggagccggatggattcgaggagccggagttcgacgacgcggactgg
gaccggctcgcggttccgtcgcactggcagctgcacgggtacggacatcccgcctacctg
aacatctcgtatccgattccggtggatccgccgttcgtgcccgatgagaacgcgaccggt
gattaccggcgcgagttcgagctgcctgcttcctggaaaggcggtcccgcggtcgtgcgg
ttcgagggcgtggactcgtgtgcgcgggtctggctcaacggcgtggagctgggggtgagc
cggggcagccggctgccggtggagttcgaggcctcggccgcgctgcgtgccgggcgcaac
gtgctggctgtccgcgtgcatcagtactcttcgggcacctacctggaagaccaggacacc
tggcggatgtcggggatcttccgcgaggtgtcggtggtggcgcggcccgacggcgggctg
cgggacgtgttcgtccatgccgacttcgacgcggtcaccggcggcgggcggctgcggatc
gaggcggacgcggccggcccggctcgggtgagcatcgccggactcgacgtccacgacctg
ccggccgacggggtcttcgagttcgaccgcgtgcggccgtggagcgctgaagacccctat
ctgtacgaggcggtcatcagcaccgatgaggagcaggtgcgggtccgcctggggttccgc
agcatcgcgatcaccgaatcaggagtgctgacggtcaacggacggcgcatcgtgctgcgc
ggtgtcaaccggcacgagttcgacccggacggcggcagggtcctgacgcgcgaggcgatg
cgggccgacgtggagctgatgaagcagcacaacatcaacgccgtacgcacctcccactat
ccgccacacccctatttcctcgacctctgcgacgagctgggtctgtgggtggtgctcgag
tgcgacctggagacgcacggcttcgagaacgccgacaccgtccgctgggaccggaacccc
tcggacgatccgcggtggcgggcggcgtacctggaccgcatcgcgcggacggtcgagcgc
gacaagaaccacccgagcgtgatcctgtggtcgctgggcaacgaggccggcgagggggtg
aacctcgaggcgatggcggcgtggacccgcgagcgggacccgtcccggccgatccactac
gaggccgaccatttcgcccgcttcacagacgtgtacgcgcagatgtaccgcactcccgcc
gacgtcgcccggatcggtcgcggagaactccgcccgggtgagagcttctatccggctgcc
gacggcgagggcgaccccgcggacgagccgcgcaatcagatgccattcctgctgaccgaa
ttcggccacgcgatgggcaacggcccgggagcgctggccgagtacacacggctgtgggac
cggtacccacgcctgcagggcgggttcatctgggagtggatggatcagggactgcgaacc
gccgatgcgcgaggccgcgagttcttcgcctacggcggggacttcggcgaggacctgcac
gatggcaacttcatctgcgacggcttggtcttccccgatcgcacgccctcgcccggactc
ctggaataccgcaaggtcatcgaaccggtgcgcatcgaaccatcgcgcatcgcacccggc
gagaactcggcgtcggtgaagatcgagaaccgctatgacgtcatcgacacgtcccacctg
cgattcacctggtcggtggagcgaaacgggatcgaggccgccgagggcgtcctgccggtc
ccgccgctggcgccgggggagagtgtcgacgtcgcggtgcccgtgccggccgagccgccg
acggccgaaggaggcgagttctggctgaccgtccgggccgacctcgtggcgaagacggcg
tgggccgatgaaggacatcccatcgcctggggacagacccagctcgcctccaacctcgaa
ccggtacttgcgccggaaccggcgccggtcggcgccgcggttcacccggtccgcgccgag
caccacatcaccctcggtcccgggctcttcgacccggactccgggacactgctcagcctc
gccggacaaccggtccacggcccgcgcctggacctgtggcgcgcgccgaccgacaacgat
cgcggctggccgcaacacgatgccgagtactggcactcgcgcgggctgcaccgcctgcgc
caccggaccgtctcactgcacgtcgccgatgacgccctgacagtggtggtgcgaagcgcc
gctgccgcctcggtcagcggatacctcacgacgtatcggtggcaggccgagggcgaaaac
ctgcgggtgcgggtgcggaccgaacctgtcggccgctggcccgagcggggcgacgtgttc
ggcgaggcgatggtggatcccgccctcccgcccgaccagtacgccgaattggtccgccgg
gacaaggcgccctctctggcgcggcttgggctgcgatggctgctgccggcccggtggtcc
caagtcagctggttcggcgcgggacccggcgaggcctaccctgattcccgctgcgcggcc
cgcatcggacggttcgacgcaaccgtggaccagctgcagatcccgtatgtccgcccgcag
gagaacggcaaccgcatggagacgcgctggatcgaactgaccgaccccgccgggacagga
gtgcgcgtcgaaggcgacccggtgttcaacttcgccgcccgccgctggagcgatcaggcg
ctggcggcggcacgccatcagagcgacctgaccccggacacatccatccacctgcacacc
gaccacgcggtgcaagggctcggcagcgccgcggtcggcccgggagtgcttccgcagcac
cggcttgaactcggctcggcggaattcgccttcaccctgactccgatcgcaggctga

DBGET integrated database retrieval system