KEGG   Catenulispora acidiphila: Caci_5127Help
Entry
Caci_5127         CDS       T00967                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cai  Catenulispora acidiphila
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Caci_5127
Enzymes [BR:cai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Caci_5127
Exosome [BR:cai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Caci_5127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5885842..5887365
Genome map
AA seq 507 aa AA seqDB search
MVAHFVMSIDQGTTSTRCILFDRGGRLVSVSQREHKQYFPKPGWVEHDAAEIWRNLEHLA
PEALAKVGVTTGQVAAIGIANQRETTVLWDRRTGHPLGRAIVWQDTRTDELVAEYARRPD
ASTVLEHSGLPLATYFSAPRIRWMLDHNPGLRERAERGEVLFGTMESWLIWNLTGGVDGG
VHVTDVTNASRTQLMNIRTLEWDPELLDFFGVPAAMLPEIRSSAEVYGQAARALPGVRIA
AALGDQQAALFGQTCFARGEAKCTYGTGSFLLLNTGDTPVRSTHGLLTTVGYRIGTEPAV
YALEGSIAVTGSLVQWFRDSLGLITTAPEIETLARTVEDNGGCYIVPAFSGLFAPHWRSE
ARGVIVGLTSYITKGHLARAVLEATGWQTREVVDAMNADSGLALTTLKVDGGMTADNLLM
QFVADVLDAPVVRPMVAETVSLGAAYAAGLAVGYWPDLEGLRRNWHRAALWNPAMDAGRR
ESEYGNWRRAVERTFDWIQPAAEARGE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcgcacttcgtgatgtcgatcgaccagggcacgacatccacgcgctgcatcctg
ttcgaccgcggcggccgcctggtctcggtgtcccaacgcgagcacaagcagtacttcccc
aagcccggctgggtcgagcacgacgccgccgagatctggcgcaacctggaacacctggcg
cccgaggcactggccaaggtcggggtgaccaccggccaggtggccgcgatcggcatcgcc
aaccagcgcgagaccacggtgctgtgggaccgccggaccggccacccgctaggccgcgcg
atcgtctggcaggacacccgcaccgacgagctggtcgccgaatacgcgcgccgcccggac
gcctcgacagtcctggagcactccggtctgccgctggccacgtacttctccgcgccgcgc
atccgctggatgctggaccacaacccgggcctgcgcgagcgcgccgaacgcggcgaggtg
ctgttcggcacgatggagagctggctgatctggaacctcaccgggggggtggacggcggc
gtgcacgtcaccgacgtcaccaacgccagccgcacccagctgatgaatatcaggacttta
gaatgggacccggagctgctggacttcttcggcgtcccggcggcgatgctgccggagatc
cgctcctcggcggaggtctacggtcaggcggcgcgcgccctgcccggcgtccggatcgcc
gccgcgctcggggaccagcaggcggcgctgttcgggcagacctgcttcgcccgcggcgag
gcgaagtgcacgtatggaaccggcagcttcctgctgctgaacaccggcgacaccccggtg
cgctccacgcacggactgctcacgacggtcggctaccgcatcggcacggaaccggcggtc
tacgccctcgaaggctcgatcgccgtcaccggctcgctggtccagtggttccgcgacagc
ctcgggctgatcaccaccgccccggagatcgagacgctggcgcgcacggtggaggacaac
ggcggctgctacatcgtcccggccttctcaggactgttcgctccgcactggcgcagcgag
gcgcgcggcgtcatcgtcgggctgacctcctacatcaccaagggacacctggcgcgtgcg
gtcctggaggcgaccggctggcagacgcgcgaggtcgtggacgcgatgaacgccgactcg
ggtctggcgctgaccacgctcaaggtcgacggcggcatgacggccgacaacctgctgatg
cagttcgtcgcggatgtcctggacgccccggtggtccgcccgatggtcgccgagacggtg
tcgctgggcgccgcctacgccgccggcttggctgtcggctactggccggacctggaaggc
ctgcgccgcaactggcatcgcgccgctttgtggaacccggcgatggacgccggacgacgg
gagagcgagtacgggaactggcggcgcgcggtggagcggaccttcgactggatacagccc
gcggcggaggctcggggcgagtag

DBGET integrated database retrieval system