KEGG   Catenulispora acidiphila: Caci_5210Help
Entry
Caci_5210         CDS       T00967                                 

Definition
protein-L-isoaspartate(D-aspartate)O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cai  Catenulispora acidiphila
Brite
Enzymes [BR:cai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Caci_5210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5987310..5988524
Genome map
AA seq 404 aa AA seqDB search
MAEGAVSTAEVAAAVRVVPRHVFTPGLALERAYANQVVFVKRDEFGVPTSSVSAPDIQAI
MLEQAEIRPGMRLLEIGSGGYNAALMAELAGPDGEVTTIDIDPVVTERARRCLDEAGYAD
VRVVTADAEGGVPEGAPYDRIVVTVEAWDLPPAWIRQLTPHGRIVVPLLLRGMTRSIAFD
RVDDHLVSRSARLCGFVKMQGAGSRPDQGLALNHGDLTIDTDDSGAIPTAAQIEAHLRHA
PRAERWSGVRVWRWEPWDTLPLWLATDFPGYCQLSVNVPGAPAVPGPPGAPGTEPLEPAL
AIATPAIATPDGFAHLTARACPDGRIELGAHAFGPQGPQLAAAVADSIAAWNRDQRAGSG
PVITAWPIDAPLPDAADVLAVKKHVQLTVTWSKPEIPHRSQPNG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagggtgctgtcagtacggcggaggttgcggcggcggtgcgggttgtgccgcgg
catgtgttcacgccggggttggcgttggagcgtgcttatgcgaatcaggttgtgttcgtg
aagcgggatgagttcggggtgcctaccagttcggtgagtgcgccggacatacaggcgatc
atgttggagcaggcggagattcggccggggatgcggctgctggagatcggttctggtggc
tacaacgctgcgctcatggctgagcttgccgggcctgatggtgaggtcacgaccatcgat
atcgatccggtggtgactgagcgtgcccgccgctgccttgatgaggccgggtacgccgac
gtgcgtgtcgtgactgctgatgccgagggcggcgtgcccgagggtgcgccgtacgaccgg
atcgtcgtgaccgtcgaggcctgggatctgccgccggcctggatcaggcagctgacgccg
cacggtcgcatcgtcgtgcccctcctcctgcgcggcatgacccgctccatcgccttcgac
cgcgtggacgaccacctcgtcagccgctcggcacgtctgtgcggcttcgtcaagatgcag
ggcgctggcagccgtcccgaccaagggctcgccctcaaccacggcgacctcaccatcgac
accgacgacagcggcgccatccccaccgcagcgcagatcgaggcgcatctgcgccacgcc
ccccgcgccgagcggtggtccggcgtccgagtctggcgctgggagccctgggacaccctg
ccgctgtggctcgcgaccgacttccccggctactgccagctctccgtcaacgtccccgga
gcccccgccgtccccggaccgcctggcgccccaggcaccgaacccctcgaaccggccctg
gccatcgccactcccgcgatcgccacgcccgacggcttcgcccacctcaccgcccgcgcc
tgccccgacggacgcatcgagctcggcgcgcacgccttcggcccgcaaggtccgcagctg
gccgccgccgtcgccgacagcatcgcggcatggaaccgcgaccagcgcgcgggctccggt
cccgtgatcaccgcctggccgatcgacgccccgctcccggacgccgccgacgtgctcgcc
gtcaagaaacacgtccaactcaccgtgacctggtcgaaaccggaaatcccgcatcggagc
cagccaaacgggtag

DBGET integrated database retrieval system