KEGG   Catenulispora acidiphila: Caci_5272Help
Entry
Caci_5272         CDS       T00967                                 

Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
cai  Catenulispora acidiphila
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Caci_5272
Enzymes [BR:cai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     Caci_5272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6071304..6072281)
Genome map
AA seq 325 aa AA seqDB search
MIVTLTLNPSLDRTLELQTLRLGEVLRATSARIDPGGKGVNVTRVLRAFAVDSHAVIPCA
GPDGEELVRLLQKAGVPVTEVPVAGWTRSNITLVEADGRATKVNAPGGALTETEVALLAE
TVVDRCVSQSTENGGASWAVLSGSLPPGVPDDVYASLTSLFAEHGVKVAVDTSGAALLAA
VDAGPDLVKPNRQELAAAVGTPLVSLDDVVAAAEKLRSRGVKAVVASLGSDGAVLVDETG
AVFGTAEAIDPVSTVGAGDALLAGFLAAGARGADALIEGMAWARAAVGLPGSQMPGPRDV
SREGIRVVRDPGGKPAGAVPLADNG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtgaccctgaccctgaaccccagcctggaccgcacgctggagcttcagacgctg
cgcctgggcgaggtgctgcgcgccacctccgcgcggatcgaccccggcggcaagggcgtg
aacgtgacccgggtgctgcgcgccttcgccgtggactcgcacgcggtgatcccgtgcgcc
ggtcccgacggcgaggaactggtgcggctgctgcagaaagccggcgtcccggtgaccgag
gtcccggtggccggctggacccggtcgaacatcacgctggtcgaagccgacggccgggcc
acgaaggtcaacgcccccggcggggcgctgaccgaaacggaggtggcgctgctcgccgag
accgtcgtggatcggtgtgtatcgcagagtacagagaacggcggcgcctcctgggccgtt
ctgtccggcagcctgcccccgggcgtcccggacgacgtttatgcgagcttgacctcgctg
ttcgccgagcacggcgtcaaggtcgcggtcgacaccagcggtgcggcgctgctggccgcc
gtcgacgccggaccggatctggtcaagcccaaccggcaggaattggctgccgctgtcggg
acgccgctggtcagcctggacgacgtcgtcgccgccgccgagaagctgcgttcgcgcggc
gtgaaggcggtcgtggcgagcctgggttcggacggcgcggtcctggtggacgagaccggc
gcggtcttcggcacggccgaggcgatcgatccggtcagcaccgtcggtgccggggacgcg
ctgctggccggtttcctggccgccggggcgcgcggcgcggacgccttgatcgaaggcatg
gcttgggcccgggccgctgtcgggctgcccggcagccagatgcccggcccgcgggacgtc
agccgggagggcatccgggtcgtccgcgacccgggaggtaaaccggcgggcgcggtcccc
ttggccgacaacggctga

DBGET integrated database retrieval system